Bison bison bison (American bison): 104999066 Help Entry 104999066         CDS       T08726                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism bbis  Bison bison bison (American bison) Pathway bbis04060   Cytokine-cytokine receptor interaction bbis04061   Viral protein interaction with cytokine and cytokine receptor bbis04062   Chemokine signaling pathway bbis04064   NF-kappa B signaling pathway bbis04360   Axon guidance bbis04670   Leukocyte transendothelial migration bbis04672   Intestinal immune network for IgA production bbis04810   Regulation of actin cytoskeleton bbis05163   Human cytomegalovirus infection bbis05200   Pathways in cancer bbis05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     104999066 (CXCL12)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104999066 (CXCL12)    04061 Viral protein interaction with cytokine and cytokine receptor     104999066 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104999066 (CXCL12)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     104999066 (CXCL12)    04672 Intestinal immune network for IgA production     104999066 (CXCL12)    04062 Chemokine signaling pathway     104999066 (CXCL12)   09158 Development and regeneration    04360 Axon guidance     104999066 (CXCL12)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     104999066 (CXCL12)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     104999066 (CXCL12)   09163 Immune disease    05323 Rheumatoid arthritis     104999066 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     104999066 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:bbis00536]     104999066 (CXCL12) Cytokines and neuropeptides [BR:bbis04052]  Cytokines   Chemokines    104999066 (CXCL12) Glycosaminoglycan binding proteins [BR:bbis00536]  Heparan sulfate / Heparin   Chemokines    104999066 (CXCL12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  104999066 NCBI-ProteinID:  XP_010852825 UniProt:  A0A6P3INY5 LinkDB All DBs Position Unknown AA seq 167 aa AA seqDB search MGSDFWPNLTAWLMESKPRLGDGGKEQPPPPTASPQQLSRCAPSSLMLWDWDQRCLTPGT HTALFSFPFPAKPVSLSYRCPCRFFESHVAKANVKHLKILNTPNCSLQIVARLKNNNRQV CIDPKLKWIQEYLDKALNKPSPTLSGLTSALGTDPARTTVGVTSSGS NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atgggctctgatttctggcctaatctcactgcttggttaatggagtccaagccgcgtctg ggggacgggggcaaggagcagcccccaccacccacagcatcgccccagcagctgtcacgc tgtgcaccttccagcttgatgctctgggattgggaccaacgctgcctcacccctgggacc cacactgccttgttctcatttccctttccagcgaaaccggtcagcctgagctacagatgc ccttgccgattctttgagagccatgtcgccaaagccaacgtcaagcacctcaaaatcctc aacactccaaactgctcccttcagatcgtggcaagactgaagaacaacaataggcaagtg tgcattgacccgaaattgaagtggattcaggaatacctggacaaagctttaaacaaaccc agccccactctctcgggcctgacctctgccctgggaaccgacccggccaggactactgtc ggcgtcaccagcagcgggagctga

DBGET integrated database retrieval system