Bison bison bison (American bison): 105000057 Help Entry 105000057         CDS       T08726                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism bbis  Bison bison bison (American bison) Pathway bbis01522   Endocrine resistance bbis04010   MAPK signaling pathway bbis04024   cAMP signaling pathway bbis04210   Apoptosis bbis04380   Osteoclast differentiation bbis04620   Toll-like receptor signaling pathway bbis04657   IL-17 signaling pathway bbis04658   Th1 and Th2 cell differentiation bbis04659   Th17 cell differentiation bbis04660   T cell receptor signaling pathway bbis04662   B cell receptor signaling pathway bbis04668   TNF signaling pathway bbis04713   Circadian entrainment bbis04725   Cholinergic synapse bbis04728   Dopaminergic synapse bbis04915   Estrogen signaling pathway bbis04917   Prolactin signaling pathway bbis04921   Oxytocin signaling pathway bbis04926   Relaxin signaling pathway bbis04928   Parathyroid hormone synthesis, secretion and action bbis04932   Non-alcoholic fatty liver disease bbis04935   Growth hormone synthesis, secretion and action bbis05031   Amphetamine addiction bbis05132   Salmonella infection bbis05133   Pertussis bbis05135   Yersinia infection bbis05140   Leishmaniasis bbis05142   Chagas disease bbis05161   Hepatitis B bbis05162   Measles bbis05166   Human T-cell leukemia virus 1 infection bbis05167   Kaposi sarcoma-associated herpesvirus infection bbis05170   Human immunodeficiency virus 1 infection bbis05171   Coronavirus disease - COVID-19 bbis05200   Pathways in cancer bbis05207   Chemical carcinogenesis - receptor activation bbis05208   Chemical carcinogenesis - reactive oxygen species bbis05210   Colorectal cancer bbis05224   Breast cancer bbis05231   Choline metabolism in cancer bbis05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bbis05323   Rheumatoid arthritis bbis05417   Lipid and atherosclerosis bbis05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105000057 (FOS)    04668 TNF signaling pathway     105000057 (FOS)    04024 cAMP signaling pathway     105000057 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105000057 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105000057 (FOS)    04660 T cell receptor signaling pathway     105000057 (FOS)    04658 Th1 and Th2 cell differentiation     105000057 (FOS)    04659 Th17 cell differentiation     105000057 (FOS)    04657 IL-17 signaling pathway     105000057 (FOS)    04662 B cell receptor signaling pathway     105000057 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     105000057 (FOS)    04917 Prolactin signaling pathway     105000057 (FOS)    04921 Oxytocin signaling pathway     105000057 (FOS)    04926 Relaxin signaling pathway     105000057 (FOS)    04935 Growth hormone synthesis, secretion and action     105000057 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     105000057 (FOS)   09156 Nervous system    04725 Cholinergic synapse     105000057 (FOS)    04728 Dopaminergic synapse     105000057 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     105000057 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     105000057 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105000057 (FOS)    05207 Chemical carcinogenesis - receptor activation     105000057 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     105000057 (FOS)    05231 Choline metabolism in cancer     105000057 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105000057 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     105000057 (FOS)    05224 Breast cancer     105000057 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105000057 (FOS)    05170 Human immunodeficiency virus 1 infection     105000057 (FOS)    05161 Hepatitis B     105000057 (FOS)    05171 Coronavirus disease - COVID-19     105000057 (FOS)    05162 Measles     105000057 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     105000057 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     105000057 (FOS)    05135 Yersinia infection     105000057 (FOS)    05133 Pertussis     105000057 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105000057 (FOS)    05142 Chagas disease     105000057 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     105000057 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     105000057 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105000057 (FOS)    05418 Fluid shear stress and atherosclerosis     105000057 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105000057 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     105000057 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bbis03000]     105000057 (FOS)    04131 Membrane trafficking [BR:bbis04131]     105000057 (FOS) Transcription factors [BR:bbis03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     105000057 (FOS) Membrane trafficking [BR:bbis04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     105000057 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  105000057 NCBI-ProteinID:  XP_010854023 Ensembl:  ENSBBBG00000014386 UniProt:  A0A6P3II01 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDYCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSVGSMELKAEPFDDYMFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcatcctcctcccgctgcagcagcgcc tccccggccggggacagtctctcctactaccactcaccggccgactccttctccagcatg ggttctcccgtcaatgcgcaggactactgcaccgatctggccgtctccagtgccaacttc atcccaacagtgactgccatctcgaccagcccggacctacaatggctagtacagcccacc ctagtctcctccgtggccccgtcccagaccagagccccccacccctatggagtccctact ccctcagctggggcttactccagggctggagtcatgaaaaccatgacaggaggcagagct cagagcattggccggaggggcaaggtagaacagttgtccccagaagaagaagagaaaagg cgaatccgaagggaaaggaataaaatggctgcagccaaatgccggaaccggaggagggag ctgactgacaccctccaagcggagacagaccaactagaagatgagaagtcggctttgcag acagagattgccaatctgctgaaggagaaggaaaaactcgagttcatcctagcggctcac cgacctgcctgcaagatccccgatgacctgggcttcccagaagagatgtctgtggcttct cttgatctgagtgggggcctgcctgaggctgccacccctgaatctgaggaggccttcacc ctgccactcctcaatgaccctgagcccaagccctcagtggagcccgtcaagagcgtcggc agcatggagctgaaggctgagccctttgatgactacatgttcccagcatcatccaggccc agcggctcggagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcatggtggctccctggggatggggcctatggccacggagctg gagcccctgtgcaccccggtggtcacctgtactcccagctgcactacttacacgtcttcc ttcgtcttcacctaccctgaggctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaacgagccttcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system