Bison bison bison (American bison): 105000961 Help Entry 105000961         CDS       T08726                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism bbis  Bison bison bison (American bison) Pathway bbis04060   Cytokine-cytokine receptor interaction bbis04151   PI3K-Akt signaling pathway bbis04217   Necroptosis bbis04380   Osteoclast differentiation bbis04620   Toll-like receptor signaling pathway bbis04621   NOD-like receptor signaling pathway bbis04622   RIG-I-like receptor signaling pathway bbis04623   Cytosolic DNA-sensing pathway bbis04630   JAK-STAT signaling pathway bbis04650   Natural killer cell mediated cytotoxicity bbis04668   TNF signaling pathway bbis04936   Alcoholic liver disease bbis05135   Yersinia infection bbis05142   Chagas disease bbis05152   Tuberculosis bbis05160   Hepatitis C bbis05161   Hepatitis B bbis05162   Measles bbis05163   Human cytomegalovirus infection bbis05164   Influenza A bbis05165   Human papillomavirus infection bbis05167   Kaposi sarcoma-associated herpesvirus infection bbis05168   Herpes simplex virus 1 infection bbis05169   Epstein-Barr virus infection bbis05170   Human immunodeficiency virus 1 infection bbis05171   Coronavirus disease - COVID-19 bbis05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105000961 (IFNB1)    04668 TNF signaling pathway     105000961 (IFNB1)    04151 PI3K-Akt signaling pathway     105000961 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105000961 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105000961 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105000961 (IFNB1)    04621 NOD-like receptor signaling pathway     105000961 (IFNB1)    04622 RIG-I-like receptor signaling pathway     105000961 (IFNB1)    04623 Cytosolic DNA-sensing pathway     105000961 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     105000961 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     105000961 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105000961 (IFNB1)    05161 Hepatitis B     105000961 (IFNB1)    05160 Hepatitis C     105000961 (IFNB1)    05171 Coronavirus disease - COVID-19     105000961 (IFNB1)    05164 Influenza A     105000961 (IFNB1)    05162 Measles     105000961 (IFNB1)    05168 Herpes simplex virus 1 infection     105000961 (IFNB1)    05163 Human cytomegalovirus infection     105000961 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     105000961 (IFNB1)    05169 Epstein-Barr virus infection     105000961 (IFNB1)    05165 Human papillomavirus infection     105000961 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     105000961 (IFNB1)    05152 Tuberculosis     105000961 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     105000961 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105000961 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105000961 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     105000961 (IFNB1) Cytokines and neuropeptides [BR:bbis04052]  Cytokines   Interferons    105000961 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon GAT LiaF-like_C Motif Other DBs NCBI-GeneID:  105000961 NCBI-ProteinID:  XP_010855387 Ensembl:  ENSBBBG00000017422 UniProt:  A0A6P3IUX9 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MTHRCLLQMVLLLCFSTTALSRSYSLLRFQQRRSLAVCQKLLWQLPSTPQHCLEARMDFQ MPEEMKQAQQFRKEDAILVIYEMLQQIFGILTRDFSSTGWSETIIEDLLEELYGQMNRLQ PIQKEIMQKQNSTMGDTTVLHLRKYYFNLVQYLKSKEYNRCAWTVVRVQILRNFSFLTRL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacccaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt tccaggagctacagcttgcttcgattccaacaaaggcggagccttgcagtgtgtcagaaa ctcctgtggcagttaccttcaactcctcaacattgcctcgaggccaggatggacttccag atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccatattggtcatc tatgagatgctccagcagatctttggcattctcaccagagacttctccagcactggctgg tctgagaccatcatcgaggacctccttgaggaactctatgggcagatgaatcgtctgcag ccaatccagaaggaaataatgcagaagcaaaactccactatgggagacacgactgttctt cacctgaggaaatattacttcaacctcgtgcagtacctgaagtccaaggagtacaacagg tgtgcctggacagtcgtgcgagtgcaaatactcaggaatttttctttcctgacgagacta acaggttacctccgtgactga

DBGET integrated database retrieval system