Bison bison bison (American bison): 105000963 Help Entry 105000963         CDS       T08726                                  Name (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism bbis  Bison bison bison (American bison) Pathway bbis04060   Cytokine-cytokine receptor interaction bbis04151   PI3K-Akt signaling pathway bbis04217   Necroptosis bbis04380   Osteoclast differentiation bbis04620   Toll-like receptor signaling pathway bbis04621   NOD-like receptor signaling pathway bbis04622   RIG-I-like receptor signaling pathway bbis04623   Cytosolic DNA-sensing pathway bbis04630   JAK-STAT signaling pathway bbis04650   Natural killer cell mediated cytotoxicity bbis04668   TNF signaling pathway bbis04936   Alcoholic liver disease bbis05135   Yersinia infection bbis05142   Chagas disease bbis05152   Tuberculosis bbis05160   Hepatitis C bbis05161   Hepatitis B bbis05162   Measles bbis05163   Human cytomegalovirus infection bbis05164   Influenza A bbis05165   Human papillomavirus infection bbis05167   Kaposi sarcoma-associated herpesvirus infection bbis05168   Herpes simplex virus 1 infection bbis05169   Epstein-Barr virus infection bbis05170   Human immunodeficiency virus 1 infection bbis05171   Coronavirus disease - COVID-19 bbis05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105000963    04668 TNF signaling pathway     105000963    04151 PI3K-Akt signaling pathway     105000963   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105000963  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105000963  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105000963    04621 NOD-like receptor signaling pathway     105000963    04622 RIG-I-like receptor signaling pathway     105000963    04623 Cytosolic DNA-sensing pathway     105000963    04650 Natural killer cell mediated cytotoxicity     105000963   09158 Development and regeneration    04380 Osteoclast differentiation     105000963  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105000963    05161 Hepatitis B     105000963    05160 Hepatitis C     105000963    05171 Coronavirus disease - COVID-19     105000963    05164 Influenza A     105000963    05162 Measles     105000963    05168 Herpes simplex virus 1 infection     105000963    05163 Human cytomegalovirus infection     105000963    05167 Kaposi sarcoma-associated herpesvirus infection     105000963    05169 Epstein-Barr virus infection     105000963    05165 Human papillomavirus infection     105000963   09171 Infectious disease: bacterial    05135 Yersinia infection     105000963    05152 Tuberculosis     105000963   09174 Infectious disease: parasitic    05142 Chagas disease     105000963   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105000963   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105000963  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     105000963 Cytokines and neuropeptides [BR:bbis04052]  Cytokines   Interferons    105000963 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  105000963 NCBI-ProteinID:  XP_010855389 Ensembl:  ENSBBBG00000017386 UniProt:  A0A6P3ITE8 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MTHRCLLQMVLLLCFSTTALSRSYSLLRFQQRQSLAVCQKLLWQLPSTPQHCLEARMDFQ MPEEMKQAQQFRKEDAILVMYEMLQHIFGILTRDFSSTGWSETIIEDLLVELYGQMNRLE PVQKEIMQKQNFTMGDTTVLHLRKCYFNLVQYLKSKEYNRCAWTVVRVQILMNFSFLMRL TDYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacccaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt tccaggagctacagcttgcttcgattccaacaaaggcagagccttgccgtgtgtcagaaa ctcctgtggcagttaccttcaactcctcaacattgcctcgaggccaggatggacttccag atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccatactggtcatg tatgagatgctccagcacatcttcggcattctcaccagagacttctccagcactggctgg tctgagaccatcattgaggacctccttgtggaactctatgggcagatgaatcgtctggag ccagtccaaaaggaaataatgcagaagcaaaatttcactatgggagacacgactgttctt cacctgaggaaatgttatttcaacctcgtgcagtacctgaagtccaaggagtacaacagg tgtgcctggacagtcgtgcgagtgcaaatactcatgaacttttctttcctgatgagacta acagattacctccgtgactga

DBGET integrated database retrieval system