Bison bison bison (American bison): 105005564 Help Entry 105005564         CDS       T08726                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism bbis  Bison bison bison (American bison) Pathway bbis04060   Cytokine-cytokine receptor interaction bbis04151   PI3K-Akt signaling pathway bbis04630   JAK-STAT signaling pathway bbis04640   Hematopoietic cell lineage bbis04657   IL-17 signaling pathway bbis04658   Th1 and Th2 cell differentiation bbis04659   Th17 cell differentiation bbis04660   T cell receptor signaling pathway bbis04664   Fc epsilon RI signaling pathway bbis04672   Intestinal immune network for IgA production bbis05140   Leishmaniasis bbis05200   Pathways in cancer bbis05310   Asthma bbis05320   Autoimmune thyroid disease bbis05321   Inflammatory bowel disease bbis05330   Allograft rejection Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105005564 (IL4)    04151 PI3K-Akt signaling pathway     105005564 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105005564 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105005564 (IL4)    04660 T cell receptor signaling pathway     105005564 (IL4)    04658 Th1 and Th2 cell differentiation     105005564 (IL4)    04659 Th17 cell differentiation     105005564 (IL4)    04657 IL-17 signaling pathway     105005564 (IL4)    04664 Fc epsilon RI signaling pathway     105005564 (IL4)    04672 Intestinal immune network for IgA production     105005564 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105005564 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105005564 (IL4)   09163 Immune disease    05310 Asthma     105005564 (IL4)    05320 Autoimmune thyroid disease     105005564 (IL4)    05321 Inflammatory bowel disease     105005564 (IL4)    05330 Allograft rejection     105005564 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     105005564 (IL4)    00536 Glycosaminoglycan binding proteins [BR:bbis00536]     105005564 (IL4) Cytokines and neuropeptides [BR:bbis04052]  Cytokines   Interleukins    105005564 (IL4) Glycosaminoglycan binding proteins [BR:bbis00536]  Heparan sulfate / Heparin   Cytokines    105005564 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  105005564 NCBI-ProteinID:  XP_010861902 Ensembl:  ENSBBBG00000025345 UniProt:  A0A6P3JCS7 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MGLTSQLIPVLVCLLVCTSHFVHGHKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAP KNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDL LERLKTIMKEKYSKC NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccagctgatcccagtgctggtctgcttactggtatgtaccagtcac ttcgtccatggacacaagtgtgatattaccttagcagagatcatcaaaacgctgaacatc ctcacaacgagaaagaattcatgcatggagctgcctgtagcagacgtctttgctgcccca aagaacacaactgagaaggaaaccttctgcagggttggaattgagcttaggcgtatctac aggagccacacgtgcttgaacaaattcctgggcggacttgacaggaatctcaacagcttg gcaagcaagacctgttctgtgaatgaagccaagacgagcacaagtacgctgaaagacctc ttggaaaggctaaagacgattatgaaggagaaatactccaagtgttga

DBGET integrated database retrieval system