Bubalus bubalis (water buffalo): 102393791 Help Entry 102393791         CDS       T05912                                  Symbol FOS Name (RefSeq) proto-oncogene C-Fos   KO K04379   proto-oncogene protein c-fos Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub01522   Endocrine resistance bbub04010   MAPK signaling pathway bbub04024   cAMP signaling pathway bbub04210   Apoptosis bbub04380   Osteoclast differentiation bbub04620   Toll-like receptor signaling pathway bbub04657   IL-17 signaling pathway bbub04658   Th1 and Th2 cell differentiation bbub04659   Th17 cell differentiation bbub04660   T cell receptor signaling pathway bbub04662   B cell receptor signaling pathway bbub04668   TNF signaling pathway bbub04713   Circadian entrainment bbub04725   Cholinergic synapse bbub04728   Dopaminergic synapse bbub04915   Estrogen signaling pathway bbub04917   Prolactin signaling pathway bbub04921   Oxytocin signaling pathway bbub04926   Relaxin signaling pathway bbub04928   Parathyroid hormone synthesis, secretion and action bbub04932   Non-alcoholic fatty liver disease bbub04935   Growth hormone synthesis, secretion and action bbub05031   Amphetamine addiction bbub05132   Salmonella infection bbub05133   Pertussis bbub05135   Yersinia infection bbub05140   Leishmaniasis bbub05142   Chagas disease bbub05161   Hepatitis B bbub05162   Measles bbub05166   Human T-cell leukemia virus 1 infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05170   Human immunodeficiency virus 1 infection bbub05171   Coronavirus disease - COVID-19 bbub05200   Pathways in cancer bbub05207   Chemical carcinogenesis - receptor activation bbub05208   Chemical carcinogenesis - reactive oxygen species bbub05210   Colorectal cancer bbub05224   Breast cancer bbub05231   Choline metabolism in cancer bbub05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bbub05323   Rheumatoid arthritis bbub05417   Lipid and atherosclerosis bbub05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102393791 (FOS)    04668 TNF signaling pathway     102393791 (FOS)    04024 cAMP signaling pathway     102393791 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102393791 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102393791 (FOS)    04660 T cell receptor signaling pathway     102393791 (FOS)    04658 Th1 and Th2 cell differentiation     102393791 (FOS)    04659 Th17 cell differentiation     102393791 (FOS)    04657 IL-17 signaling pathway     102393791 (FOS)    04662 B cell receptor signaling pathway     102393791 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     102393791 (FOS)    04917 Prolactin signaling pathway     102393791 (FOS)    04921 Oxytocin signaling pathway     102393791 (FOS)    04926 Relaxin signaling pathway     102393791 (FOS)    04935 Growth hormone synthesis, secretion and action     102393791 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     102393791 (FOS)   09156 Nervous system    04725 Cholinergic synapse     102393791 (FOS)    04728 Dopaminergic synapse     102393791 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     102393791 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     102393791 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102393791 (FOS)    05207 Chemical carcinogenesis - receptor activation     102393791 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     102393791 (FOS)    05231 Choline metabolism in cancer     102393791 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102393791 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     102393791 (FOS)    05224 Breast cancer     102393791 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102393791 (FOS)    05170 Human immunodeficiency virus 1 infection     102393791 (FOS)    05161 Hepatitis B     102393791 (FOS)    05171 Coronavirus disease - COVID-19     102393791 (FOS)    05162 Measles     102393791 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     102393791 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102393791 (FOS)    05135 Yersinia infection     102393791 (FOS)    05133 Pertussis     102393791 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102393791 (FOS)    05142 Chagas disease     102393791 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     102393791 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     102393791 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102393791 (FOS)    05418 Fluid shear stress and atherosclerosis     102393791 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102393791 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102393791 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bbub03000]     102393791 (FOS)    04131 Membrane trafficking [BR:bbub04131]     102393791 (FOS) Transcription factors [BR:bbub03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     102393791 (FOS) Membrane trafficking [BR:bbub04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     102393791 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  102393791 NCBI-ProteinID:  XP_006053957 LinkDB All DBs Position 11:complement(16803081..16806547) Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDYCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLNGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSVGSMELKAEPFDDYMFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcatcctcctcccgctgcagcagcgcc tccccggccggggacagtctctcctactaccactcaccggccgactccttctccagcatg ggttctcccgtcaatgcgcaggactactgcaccgatctggccgtctccagtgccaacttc atcccaacagtgactgccatctcgaccagcccggacctacaatggctagtacagcccacc ctagtctcctccgtggccccgtcccagaccagagccccccacccctatggagtccctact ccctcagctggggcttactccagggctggagtcatgaaaaccatgacgggaggcagagct cagagcattggccggaggggcaaggtagaacagttgtccccagaagaagaagagaaaagg cgaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagggag ctgactgacaccctccaagcggagacagaccaactagaagatgagaagtcggctttgcag acagagattgccaatctgctgaaggagaaggaaaaactcgaattcatcctagcggctcac cgacctgcctgcaagatccccgacgacctgggcttcccagaagagatgtctgtggcttcc cttgatctgaatgggggcctgcctgaggctgccacccctgaatccgaggaggccttcacc ctgcccctcctcaatgaccctgagcccaagccctcagtggagcccgtcaagagcgtcggc agcatggagctgaaggctgagccctttgatgactacatgttcccagcatcgtccaggccc agcggctcggagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcacggtggctccctggggatggggcctatggccacggagctg gagcccctgtgcaccccagtggtcacctgtactcccagctgcactacttacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaacgagccttcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system