Bubalus bubalis (water buffalo): 102400135 Help Entry 102400135         CDS       T05912                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04010   MAPK signaling pathway bbub04014   Ras signaling pathway bbub04015   Rap1 signaling pathway bbub04024   cAMP signaling pathway bbub04062   Chemokine signaling pathway bbub04510   Focal adhesion bbub04517   IgSF CAM signaling bbub04520   Adherens junction bbub04611   Platelet activation bbub04670   Leukocyte transendothelial migration bbub04720   Long-term potentiation bbub04722   Neurotrophin signaling pathway bbub04934   Cushing syndrome bbub04972   Pancreatic secretion bbub05211   Renal cell carcinoma bbub05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102400135 (RAP1B)    04014 Ras signaling pathway     102400135 (RAP1B)    04015 Rap1 signaling pathway     102400135 (RAP1B)    04024 cAMP signaling pathway     102400135 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     102400135 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     102400135 (RAP1B)    04520 Adherens junction     102400135 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102400135 (RAP1B)    04670 Leukocyte transendothelial migration     102400135 (RAP1B)    04062 Chemokine signaling pathway     102400135 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     102400135 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     102400135 (RAP1B)    04722 Neurotrophin signaling pathway     102400135 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     102400135 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102400135 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102400135 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     102400135 (RAP1B)    04031 GTP-binding proteins [BR:bbub04031]     102400135 (RAP1B) Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102400135 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    102400135 (RAP1B)   Exosomal proteins of colorectal cancer cells    102400135 (RAP1B) GTP-binding proteins [BR:bbub04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     102400135 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  102400135 NCBI-ProteinID:  XP_025139717 LinkDB All DBs Position 4:75216121..75260970 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcgggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcctggatactgcagga acggaacaattcacagcaatgagggatttgtacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacacggatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcgacaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcgtca tgtcagctgctttaa

DBGET integrated database retrieval system