Bubalus bubalis (water buffalo): 102402056 Help Entry 102402056         CDS       T05912                                  Name (RefSeq) interferon beta-2   KO K05415   interferon beta Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04060   Cytokine-cytokine receptor interaction bbub04151   PI3K-Akt signaling pathway bbub04217   Necroptosis bbub04380   Osteoclast differentiation bbub04620   Toll-like receptor signaling pathway bbub04621   NOD-like receptor signaling pathway bbub04622   RIG-I-like receptor signaling pathway bbub04623   Cytosolic DNA-sensing pathway bbub04630   JAK-STAT signaling pathway bbub04650   Natural killer cell mediated cytotoxicity bbub04668   TNF signaling pathway bbub04936   Alcoholic liver disease bbub05135   Yersinia infection bbub05142   Chagas disease bbub05152   Tuberculosis bbub05160   Hepatitis C bbub05161   Hepatitis B bbub05162   Measles bbub05163   Human cytomegalovirus infection bbub05164   Influenza A bbub05165   Human papillomavirus infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05168   Herpes simplex virus 1 infection bbub05169   Epstein-Barr virus infection bbub05170   Human immunodeficiency virus 1 infection bbub05171   Coronavirus disease - COVID-19 bbub05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102402056    04668 TNF signaling pathway     102402056    04151 PI3K-Akt signaling pathway     102402056   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102402056  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102402056  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102402056    04621 NOD-like receptor signaling pathway     102402056    04622 RIG-I-like receptor signaling pathway     102402056    04623 Cytosolic DNA-sensing pathway     102402056    04650 Natural killer cell mediated cytotoxicity     102402056   09158 Development and regeneration    04380 Osteoclast differentiation     102402056  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102402056    05161 Hepatitis B     102402056    05160 Hepatitis C     102402056    05171 Coronavirus disease - COVID-19     102402056    05164 Influenza A     102402056    05162 Measles     102402056    05168 Herpes simplex virus 1 infection     102402056    05163 Human cytomegalovirus infection     102402056    05167 Kaposi sarcoma-associated herpesvirus infection     102402056    05169 Epstein-Barr virus infection     102402056    05165 Human papillomavirus infection     102402056   09171 Infectious disease: bacterial    05135 Yersinia infection     102402056    05152 Tuberculosis     102402056   09174 Infectious disease: parasitic    05142 Chagas disease     102402056   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102402056   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102402056  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbub04052]     102402056 Cytokines and neuropeptides [BR:bbub04052]  Cytokines   Interferons    102402056 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102402056 NCBI-ProteinID:  XP_025137243 LinkDB All DBs Position 3:86014498..86015218 Genome browser AA seq 186 aa AA seqDB search MTHRCLLQMVLLLCFSTTALSRSYSLLRFQQRRSAAVCQKLLWQLPSTPQHCLEFRMDFQ MPEEMKQAQQFQKEDAILVMYEMLQQIFGILTRDFSSTGWSETIIEDLLEELYGQMNRLE PIQKEIMQKQNSTMGDKTVLHLRKYYFNLVQYLKFKEYNRCAWTVVRVQILRNFSFLTRL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacccaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt tccaggagctacagcttgcttcgattccaacaaaggcggagtgctgcggtgtgtcagaaa ctcctgtggcagttaccttcaactcctcaacattgcctcgagttcaggatggacttccag atgcctgaggagatgaagcaagcacagcagttccagaaggaagatgccatattggtcatg tatgagatgctccagcagatcttcggcattctcaccagagacttctccagcactggctgg tctgagaccatcattgaggacctccttgaggaactctatgggcagatgaatcgtctggag ccaatccagaaggaaataatgcagaagcaaaactccactatgggagacaagaccgttctt cacctgaggaaatattacttcaacctcgtgcagtacctgaagttcaaggagtacaataga tgtgcctggacagtcgtgcgagtgcaaatactcaggaacttttctttcctgacgagacta acaggttatctccgtgactga

DBGET integrated database retrieval system