Bubalus bubalis (water buffalo): 102412787 Help Entry 102412787         CDS       T05912                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub01522   Endocrine resistance bbub04110   Cell cycle bbub04115   p53 signaling pathway bbub04151   PI3K-Akt signaling pathway bbub04218   Cellular senescence bbub04530   Tight junction bbub04660   T cell receptor signaling pathway bbub04933   AGE-RAGE signaling pathway in diabetic complications bbub04934   Cushing syndrome bbub05160   Hepatitis C bbub05162   Measles bbub05163   Human cytomegalovirus infection bbub05164   Influenza A bbub05165   Human papillomavirus infection bbub05166   Human T-cell leukemia virus 1 infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05169   Epstein-Barr virus infection bbub05200   Pathways in cancer bbub05203   Viral carcinogenesis bbub05212   Pancreatic cancer bbub05214   Glioma bbub05218   Melanoma bbub05219   Bladder cancer bbub05220   Chronic myeloid leukemia bbub05222   Small cell lung cancer bbub05223   Non-small cell lung cancer bbub05224   Breast cancer bbub05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     102412787 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     102412787 (CDK4)    04115 p53 signaling pathway     102412787 (CDK4)    04218 Cellular senescence     102412787 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     102412787 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     102412787 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102412787 (CDK4)    05203 Viral carcinogenesis     102412787 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     102412787 (CDK4)    05225 Hepatocellular carcinoma     102412787 (CDK4)    05214 Glioma     102412787 (CDK4)    05220 Chronic myeloid leukemia     102412787 (CDK4)    05218 Melanoma     102412787 (CDK4)    05219 Bladder cancer     102412787 (CDK4)    05224 Breast cancer     102412787 (CDK4)    05222 Small cell lung cancer     102412787 (CDK4)    05223 Non-small cell lung cancer     102412787 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102412787 (CDK4)    05160 Hepatitis C     102412787 (CDK4)    05164 Influenza A     102412787 (CDK4)    05162 Measles     102412787 (CDK4)    05163 Human cytomegalovirus infection     102412787 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     102412787 (CDK4)    05169 Epstein-Barr virus infection     102412787 (CDK4)    05165 Human papillomavirus infection     102412787 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102412787 (CDK4)    04934 Cushing syndrome     102412787 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102412787 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:bbub01001]     102412787 (CDK4) Enzymes [BR:bbub01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      102412787 (CDK4) Protein kinases [BR:bbub01001]  Serine/threonine kinases: CMGC group   CDK family    102412787 (CDK4) SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  102412787 NCBI-ProteinID:  XP_006077980 LinkDB All DBs Position 4:complement(64700293..64703276) Genome browser AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG DAE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctcccgatatgagccagtggctgagattggtgtcggtgcctatgggacagtg tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtaagagtcccc aatggaggaggtgctggagggggcctgcccatcagcaccgttcgggaggtggccttactg cggcgtctggaggcttttgagcatcccaatgttgtcaggctcatggatgtctgtgcaaca gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcatgtggaccaagacctc aggacctatctggacaaggcacccccaccaggcttgccagtggagaccataaaggatctg atgcgccaatttctaagaggcctggatttccttcatgccaactgcatcgttcaccgagac ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtat cgtgctccagaagttcttttgcagtctacgtatgcaacacccgtggacatgtggagcgtt ggctgtatcttcgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct gaccagttaggcaaaatctttgacctgattggactgcccccagaggatgactggccccga gatgtctctctaccccgaggagccttttcccccagagggccccgcccagtgcagtcggtg gtccctgagctggaggaatctggagcacagctgctgctggagatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcactcttatctacacaaggcagaaggt gacgcagagtga

DBGET integrated database retrieval system