Bubalus bubalis (water buffalo): 102413719 Help Entry 102413719         CDS       T05912                                  Symbol ACTB Name (RefSeq) actin, cytoplasmic 1 isoform X1   KO K05692   actin beta/gamma 1 Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub03082   ATP-dependent chromatin remodeling bbub04015   Rap1 signaling pathway bbub04145   Phagosome bbub04210   Apoptosis bbub04390   Hippo signaling pathway bbub04510   Focal adhesion bbub04520   Adherens junction bbub04530   Tight junction bbub04611   Platelet activation bbub04613   Neutrophil extracellular trap formation bbub04670   Leukocyte transendothelial migration bbub04714   Thermogenesis bbub04810   Regulation of actin cytoskeleton bbub04814   Motor proteins bbub04820   Cytoskeleton in muscle cells bbub04919   Thyroid hormone signaling pathway bbub04921   Oxytocin signaling pathway bbub04971   Gastric acid secretion bbub05014   Amyotrophic lateral sclerosis bbub05100   Bacterial invasion of epithelial cells bbub05132   Salmonella infection bbub05135   Yersinia infection bbub05164   Influenza A bbub05205   Proteoglycans in cancer bbub05225   Hepatocellular carcinoma bbub05410   Hypertrophic cardiomyopathy bbub05412   Arrhythmogenic right ventricular cardiomyopathy bbub05414   Dilated cardiomyopathy bbub05416   Viral myocarditis bbub05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102413719 (ACTB)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102413719 (ACTB)    04390 Hippo signaling pathway     102413719 (ACTB)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102413719 (ACTB)   09143 Cell growth and death    04210 Apoptosis     102413719 (ACTB)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102413719 (ACTB)    04520 Adherens junction     102413719 (ACTB)    04530 Tight junction     102413719 (ACTB)   09142 Cell motility    04814 Motor proteins     102413719 (ACTB)    04820 Cytoskeleton in muscle cells     102413719 (ACTB)    04810 Regulation of actin cytoskeleton     102413719 (ACTB)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102413719 (ACTB)    04613 Neutrophil extracellular trap formation     102413719 (ACTB)    04670 Leukocyte transendothelial migration     102413719 (ACTB)   09152 Endocrine system    04921 Oxytocin signaling pathway     102413719 (ACTB)    04919 Thyroid hormone signaling pathway     102413719 (ACTB)   09154 Digestive system    04971 Gastric acid secretion     102413719 (ACTB)   09159 Environmental adaptation    04714 Thermogenesis     102413719 (ACTB)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102413719 (ACTB)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102413719 (ACTB)   09172 Infectious disease: viral    05164 Influenza A     102413719 (ACTB)   09171 Infectious disease: bacterial    05132 Salmonella infection     102413719 (ACTB)    05135 Yersinia infection     102413719 (ACTB)    05100 Bacterial invasion of epithelial cells     102413719 (ACTB)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102413719 (ACTB)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102413719 (ACTB)    05410 Hypertrophic cardiomyopathy     102413719 (ACTB)    05412 Arrhythmogenic right ventricular cardiomyopathy     102413719 (ACTB)    05414 Dilated cardiomyopathy     102413719 (ACTB)    05416 Viral myocarditis     102413719 (ACTB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:bbub03021]     102413719 (ACTB)    03019 Messenger RNA biogenesis [BR:bbub03019]     102413719 (ACTB)    03036 Chromosome and associated proteins [BR:bbub03036]     102413719 (ACTB)    03029 Mitochondrial biogenesis [BR:bbub03029]     102413719 (ACTB)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bbub04812]     102413719 (ACTB)    04147 Exosome [BR:bbub04147]     102413719 (ACTB) Transcription machinery [BR:bbub03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      102413719 (ACTB) Messenger RNA biogenesis [BR:bbub03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      102413719 (ACTB) Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      102413719 (ACTB)     NuA4 complex      102413719 (ACTB)   Chromatin remodeling factors    BAF complex     102413719 (ACTB)    PBAF complex     102413719 (ACTB)    GBAF(ncBAF) complex     102413719 (ACTB)    SWR1 complex     102413719 (ACTB) Mitochondrial biogenesis [BR:bbub03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     102413719 (ACTB) Cytoskeleton proteins [BR:bbub04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      102413719 (ACTB) Exosome [BR:bbub04147]  Exosomal proteins   Proteins found in most exosomes    102413719 (ACTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  102413719 NCBI-ProteinID:  XP_025130274 EnsemblRapid:  ENSBBUG00015015914 LinkDB All DBs Position 24:complement(3483285..3486733) Genome browser AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgatgatattgctgcgctcgtggtcgacaacggctccggcatgtgcaaggccggc ttcgcgggcgacgatgctccccgggccgtcttcccctccatcgtggggcgcccccggcac cagggcgtaatggtgggcatgggccagaaggactcgtacgtgggggatgaggctcagagc aagagaggcatcctgaccctcaagtaccccattgagcacggcatcgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagctccgtgtggcccctgaggag caccccgtgctgctgaccgaggcccccctgaaccccaaggccaaccgtgaaaaaatgacc cagatcatgttcgagaccttcaacacccctgccatgtacgtggccatccaggccgtgctg tccctgtacgcctctggccgcaccactggcatcgtgatggactccggtgacggggtcacc cacacggtgcccatctacgaggggtacgcccttccccatgccatcctgcgtctggacctg gctggccgggacctgacggactacctcatgaagatcctcacggagcgtggctacagcttc accaccacggccgagcgggaaatcgtccgtgacatcaaggagaagctctgctacgtggcc ctggacttcgagcaggagatggccaccgcggcctccagctcctccctggagaagagctac gagcttcctgacgggcaggtcatcaccatcggcaatgagcggttccgctgccctgaggct ctcttccagccttccttcctgggcatggaatcctgcggtattcacgaaactaccttcaat tccatcatgaagtgtgatgtcgacatccgcaaggacctctacgccaacacagtgctgtcc ggcgggaccaccatgtaccccggcatcgcggacaggatgcagaaagagatcactgccctg gcacccagcacaatgaagatcaagatcatcgcgccccctgagcgcaagtactctgtgtgg attggcggctccatcttggcctcgctgtccaccttccagcagatgtggatcagcaagcag gagtacgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system