Bufo bufo (common toad): 121003414 Help Entry 121003414         CDS       T07950                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism bbuf  Bufo bufo (common toad) Pathway bbuf04060   Cytokine-cytokine receptor interaction bbuf04672   Intestinal immune network for IgA production bbuf04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:bbuf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121003414 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121003414 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     121003414 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbuf04052]     121003414 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:bbuf00536]     121003414 (CXCL12) Cytokines and neuropeptides [BR:bbuf04052]  Cytokines   Chemokines    121003414 (CXCL12) Glycosaminoglycan binding proteins [BR:bbuf00536]  Heparan sulfate / Heparin   Chemokines    121003414 (CXCL12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  121003414 NCBI-ProteinID:  XP_040291191 LinkDB All DBs Position 6:complement(201636253..201756610) Genome browser AA seq 89 aa AA seqDB search MDMRNLAFLTLLLGLFCFSEEKPVSLTYRCPCRYFESNVAKSNIKHLKILSTTNCSLQIV ARLKHNGKQICLDPKIKWIQEYLDKALNK NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggatatgaggaacctcgctttccttaccctactgctggggcttttctgtttctctgaa gagaaaccagtcagcttgacttaccgatgtccttgtagatattttgaaagtaatgtggcc aagagcaacatcaaacacctgaagattctgtccaccaccaactgctctctgcagattgtg gctcgtcttaagcacaatggaaaacagatttgcttggaccctaagattaagtggatccaa gagtacctggataaagctttgaacaagtaa

DBGET integrated database retrieval system