Bacillus cereus ATCC 14579: BC2192 Help Entry BC2192            CDS       T00127                                  Name (GenBank) Dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism bce  Bacillus cereus ATCC 14579 Pathway bce00670   One carbon pool by folate bce00790   Folate biosynthesis bce01100   Metabolic pathways bce01240   Biosynthesis of cofactors bce04981   Folate transport and metabolism Module bce_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bce00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BC2192    00670 One carbon pool by folate     BC2192  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     BC2192 Enzymes [BR:bce01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      BC2192 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AAP09158 UniProt:  Q81E04 LinkDB All DBs Position 2138821..2139309 Genome browser AA seq 162 aa AA seqDB search MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN IIVTRNEGYHVEGCEVVHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA FEGDTFFPEIDMTNWKEIFVEKGLTDEKNPYTYYYHVYEKQQ NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgattgtttcatttatggtcgctatggacgaaaatagagtaattggtaaagataataat ttaccttggcgtttaccgagtgaattacaatacgtgaagaaaacaacgatgggtcacccg cttattatgggaagaaagaactatgaagcgattggtagaccactgcctggaagacgtaat attattgtaactcgtaatgaagggtatcatgttgaaggttgtgaagttgttcattctgta gaagaagtgtttgaactatgtaaaaatgaagaagagatttttatttttggtggagcgcaa atttacgacctctttttaccttatgtagacaagttatatataacaaaaatccatcatgca tttgaaggagatacattcttcccagaaatagatatgacaaattggaaagagatttttgta gaaaaaggtttaacggatgaaaaaaacccatatacgtattattaccatgtatatgagaaa caacaataa

DBGET integrated database retrieval system