Bacteroides cellulosilyticus: BcellWH2_03507
Help
Entry
BcellWH2_03507 CDS
T04116
Symbol
fabG_4
Name
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase FabG
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
bcel
Bacteroides cellulosilyticus
Pathway
bcel00061
Fatty acid biosynthesis
bcel00780
Biotin metabolism
bcel01100
Metabolic pathways
bcel01110
Biosynthesis of secondary metabolites
bcel01212
Fatty acid metabolism
bcel01240
Biosynthesis of cofactors
Module
bcel_M00083
Fatty acid biosynthesis, elongation
bcel_M00572
Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:
bcel00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
BcellWH2_03507 (fabG_4)
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
BcellWH2_03507 (fabG_4)
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
BcellWH2_03507 (fabG_4)
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
bcel01004
]
BcellWH2_03507 (fabG_4)
Enzymes [BR:
bcel01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
BcellWH2_03507 (fabG_4)
Lipid biosynthesis proteins [BR:
bcel01004
]
Fatty acid synthase
Component type
BcellWH2_03507 (fabG_4)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
Epimerase
Motif
Other DBs
NCBI-ProteinID:
ALJ60730
UniProt:
A0A0P0GLB9
LinkDB
All DBs
Position
4534169..4534915
Genome browser
AA seq
248 aa
AA seq
DB search
MGLLDGKTAIVTGAARGIGKAIALKFASEGANIAFTDLVIDENAENTAKEIEAMGVKAKG
YASNAANFEDTAKVVEAIHADFGRIDILVNNAGITRDGLMMRMSEQQWDMVINVNLKSAF
NFVHACTPIMMRQKAGSIINMASVVGVHGNAGQANYAASKAGMIALAKSIAQELGSRGIR
ANAIAPGFILTDMTAALSDEVRAEWAKKIPLRRGGTPEDVANIATFLASDMSSYVSGQVI
QVDGGMNM
NT seq
747 nt
NT seq
+upstream
nt +downstream
nt
atgggattattagatggaaaaacagccattgtaactggtgctgcacgcggtatcggtaag
gctatcgcattaaagttcgcttctgaaggagcaaatatcgcattcactgacctggtgatt
gatgaaaatgcagagaatacggcaaaagaaattgaagcaatgggcgtgaaagctaaaggt
tatgcttcaaatgctgctaattttgaagatactgccaaggtggtagaagctattcatgca
gactttggccgcatcgatattttggtaaacaatgcaggtatcacccgtgacggtctgatg
atgcgtatgagcgagcaacaatgggatatggttatcaacgttaacttgaaatccgctttc
aatttcgttcatgcttgtactccgatcatgatgcgccagaaagctggtagcattatcaat
atggcttctgtagtaggtgttcacggtaatgccggacaagccaactacgcagcttccaaa
gctggtatgatcgctctggctaaatctattgcacaggaattaggttctcgcggtatccgt
gccaacgctatcgctccgggttttatcctgactgatatgactgctgcattgtctgacgag
gtaagagctgaatgggcaaagaagattcctttgcgtcgcggcggtactcccgaagacgtg
gcaaacattgctaccttcctagcttctgatatgtcttcttatgtatcaggacaggtgatt
caggtagatggtggtatgaatatgtaa
DBGET
integrated database retrieval system