Heyndrickxia coagulans 2-6: BCO26_0063 Help Entry BCO26_0063        CDS       T01527                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bck  Heyndrickxia coagulans 2-6 Pathway bck00790   Folate biosynthesis bck01100   Metabolic pathways bck01240   Biosynthesis of cofactors Module bck_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bck00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BCO26_0063 (folB) Enzymes [BR:bck01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BCO26_0063 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BCO26_0063 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BCO26_0063 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AEH52122 LinkDB All DBs Position 65265..65633 Genome browser AA seq 122 aa AA seqDB search MDKIYIHDMEFYGYHGVLPEENKLGQRFRVSIVLGLDLKRAGETDRLEETVSYADVYACV KKIVEGQPFKLLEAVAEKLAASILALYEKVAEVTVKVTKPDPPIPGHYKSVAVEITRRRK NG NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggacaaaatttatattcatgatatggaattttacggttaccacggcgtattgcccgag gaaaacaaactgggccagcgcttccgtgtatccatcgtgcttggtctggatttaaagcgg gcgggcgaaaccgaccggctggaagaaaccgtcagttatgcggatgtctatgcatgcgtg aaaaaaattgttgaagggcagcctttcaagctccttgaagctgttgcagaaaaactggct gcttccattctcgctttatatgaaaaagttgcggaagtcacagtcaaagtaaccaaaccg gacccgcccattcccggccattacaagtccgttgcggtagaaattacaaggagaagaaag aatggataa

DBGET integrated database retrieval system