Bradysia coprophila: 119072690 Help Entry 119072690         CDS       T08269                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism bcoo  Bradysia coprophila Pathway bcoo00510   N-Glycan biosynthesis bcoo00513   Various types of N-glycan biosynthesis bcoo04141   Protein processing in endoplasmic reticulum Module bcoo_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:bcoo00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     119072690    00513 Various types of N-glycan biosynthesis     119072690  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     119072690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Cation_efflux TctB DUF6512 Motif Other DBs NCBI-GeneID:  119072690 NCBI-ProteinID:  XP_037033855 LinkDB All DBs Position IV Genome browser AA seq 85 aa AA seqDB search MDSSFTRYVSPVNPSVFPHLATVLLTIGTFFTAWFFVFEVSRPRSNDNESPKESVIFKEL LISLFAAVFLGFGALFLLLTVGIYV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggactcatcattcaccagatacgtttcaccagtgaatccttccgtatttccccactta gcaacggttttgctgaccattggaacgtttttcactgcatggtttttcgtgtttgaagtt tcacgaccgagatcaaatgacaatgaatcgccgaaggagtctgtcatctttaaagagctg ttgatcagtctatttgctgctgtgttcctcggcttcggagctctgtttctgttgctgacc gttggaatttacgtataa

DBGET integrated database retrieval system