Bacillus cereus 03BB102: BCA_2322 Help Entry BCA_2322          CDS       T00869                                  Symbol dfrA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism bcx  Bacillus cereus 03BB102 Pathway bcx00670   One carbon pool by folate bcx00790   Folate biosynthesis bcx01100   Metabolic pathways bcx01240   Biosynthesis of cofactors bcx04981   Folate transport and metabolism Module bcx_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bcx00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BCA_2322 (dfrA)    00670 One carbon pool by folate     BCA_2322 (dfrA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     BCA_2322 (dfrA) Enzymes [BR:bcx01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      BCA_2322 (dfrA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 RH_dom Motif Other DBs NCBI-ProteinID:  ACO28752 UniProt:  A0A158RNI0 LinkDB All DBs Position 2158714..2159202 Genome browser AA seq 162 aa AA seqDB search MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN IIVTRNGGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA FEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgatagtttcatttatggtcgcaatggacgagaatcgagtaattggtaaagataataat ttaccttggcgcttaccaagtgaattgcagtatgtgaagaaaacaacgatgggtcatccg cttattatggggagaaagaattatgaagcgattggtagaccactgcctggaagacgtaat attattgtaactcgcaatggagggtatcatgttgaaggttgtgaagtagcacattctgta gaagaagtgtttgaactatgcaaaaatgaagaagagatctttatttttggtggagcacaa atttatgatctctttttaccttacgtagacaagttatatataacaaaaatccatcatgca tttgaaggagatacattcttcccagaaatggatatgacaaattggaaagaagtttttgtt gaaaaaggtttaacggatgaaaaaaatccgtatacgtattattaccatgtatatgagaaa caacaataa

DBGET integrated database retrieval system