Brachypodium distachyon (stiff brome): 100826136 Help Entry 100826136         CDS       T01717                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bdi  Brachypodium distachyon (stiff brome) Pathway bdi03420   Nucleotide excision repair bdi04120   Ubiquitin mediated proteolysis bdi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bdi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100826136    04120 Ubiquitin mediated proteolysis     100826136   09124 Replication and repair    03420 Nucleotide excision repair     100826136  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bdi04121]     100826136    03400 DNA repair and recombination proteins [BR:bdi03400]     100826136 Enzymes [BR:bdi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      100826136 Ubiquitin system [BR:bdi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    100826136   Multi subunit type E3    SCF complex     Ring finger protein      100826136    Cul2 complex      100826136    Cul3 complex      100826136    Cul4 complex      100826136    Cul7 complex      100826136    Cul8 complex      100826136    Cul9 complex      100826136 DNA repair and recombination proteins [BR:bdi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       100826136     TCR (transcription coupled repair) factors      Cul4-CSA complex       100826136 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  100826136 NCBI-ProteinID:  XP_003570204 UniProt:  C3SA59 LinkDB All DBs Position 3:53495901..53499104 Genome browser AA seq 116 aa AA seqDB search MDQGDVAVAVPPAAASPSCAGAGCKKGKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaccagggcgacgtcgccgtggccgtgccccccgccgctgcctccccctcctgcgcc ggcgccgggtgcaagaagggcaagcgcttcgaggtcaagaagtggaacgccgtcgcgctc tgggcctgggacatcgtggtcgacaactgcgcaatctgccgcaaccacattatggacctc tgcatcgagtgccaggcgaaccaggccagcgccaccagcgaggagtgcaccgtcgcttgg ggagtttgcaaccatgcattccacttccactgcatcagccgttggctcaagacccgtcaa gtgtgccctctagacaacagtgagtgggagttccagaagtatggtcactag

DBGET integrated database retrieval system