Brachypodium distachyon (stiff brome): 100841533 Help Entry 100841533         CDS       T01717                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bdi  Brachypodium distachyon (stiff brome) Pathway bdi03420   Nucleotide excision repair bdi04120   Ubiquitin mediated proteolysis bdi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bdi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100841533    04120 Ubiquitin mediated proteolysis     100841533   09124 Replication and repair    03420 Nucleotide excision repair     100841533  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bdi04121]     100841533    03400 DNA repair and recombination proteins [BR:bdi03400]     100841533 Enzymes [BR:bdi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      100841533 Ubiquitin system [BR:bdi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    100841533   Multi subunit type E3    SCF complex     Ring finger protein      100841533    Cul2 complex      100841533    Cul3 complex      100841533    Cul4 complex      100841533    Cul7 complex      100841533    Cul8 complex      100841533    Cul9 complex      100841533 DNA repair and recombination proteins [BR:bdi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       100841533     TCR (transcription coupled repair) factors      Cul4-CSA complex       100841533 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  100841533 NCBI-ProteinID:  XP_003569574 UniProt:  I1HB59 LinkDB All DBs Position 2:319715..322921 Genome browser AA seq 126 aa AA seqDB search MSAMETDGPDAPPPAPAPAPAGEGSSAAGPSSSRKSNKRFEIKKWNAVALWAWDIVVDNC AICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWE FQKYGH NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgtctgccatggagacggacggccccgacgcgccgccgcccgcccccgcccccgccccc gccggcgagggctcctccgccgccgggccctcctcctcccgcaagtccaacaagcgcttc gagatcaagaagtggaacgccgtcgcgctctgggcatgggatatcgtcgtcgacaactgc gccatctgccgcaaccacatcatggatctatgcatcgagtgccaggcgaaccaggccagc gccaccagcgaggagtgcactgtcgcctggggtgtctgtaatcatgcttttcacttccac tgcatcagcaggtggctcaagactcgtcaagtgtgcccattagacaacagcgaatgggag ttccagaaatatggccactag

DBGET integrated database retrieval system