Bacteroides finegoldii: BFINE_31910 Help Entry BFINE_31910       CDS       T09648                                  Name (GenBank) hypothetical protein   KO K01658   anthranilate synthase component II [EC:4.1.3.27] Organism bfin  Bacteroides finegoldii Pathway bfin00400   Phenylalanine, tyrosine and tryptophan biosynthesis bfin01100   Metabolic pathways bfin01110   Biosynthesis of secondary metabolites bfin01230   Biosynthesis of amino acids bfin02024   Quorum sensing Module bfin_M00023   Tryptophan biosynthesis, chorismate => tryptophan Brite KEGG Orthology (KO) [BR:bfin00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     BFINE_31910   09110 Biosynthesis of other secondary metabolites    00405 Phenazine biosynthesis     BFINE_31910  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BFINE_31910 Enzymes [BR:bfin01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.3  Oxo-acid-lyases     4.1.3.27  anthranilate synthase      BFINE_31910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GATase Motif Other DBs NCBI-ProteinID:  BDW77396 LinkDB All DBs Position complement(2774971..2775291) Genome browser AA seq 106 aa AA seqDB search MKILLLDNYDSFTYNLLHVVKELGATDVEVVRNDQIELDEVDRFDKIILSPGPGIPEEAG LLLPIIKRYAPTKSILGSAWVIRLSAKPSEHVWKTSKKYIMVYKLR NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgaaaatattacttttagataactacgactctttcacctataacctgctgcatgtagtg aaagaattaggggctacagatgtagaagtagtccgcaacgaccagatagaacttgatgaa gtagatcgttttgataaaatcatcctgtctcccggaccgggcatacccgaagaagccgga ttgttactacctattattaagagatacgctccgaccaaaagcattctggggtctgcttgg gtcatcaggctatcggcgaagccttcggagcacgtctggaaaacctcaaagaagtatatc atggtgtacaaactccggtaa

DBGET integrated database retrieval system