Brachyistius frenatus (kelp perch): 138626557 Help Entry 138626557         CDS       T10614                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism bfre  Brachyistius frenatus (kelp perch) Pathway bfre00510   N-Glycan biosynthesis bfre00513   Various types of N-glycan biosynthesis bfre04141   Protein processing in endoplasmic reticulum Module bfre_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:bfre00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     138626557 (tmem258)    00513 Various types of N-glycan biosynthesis     138626557 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     138626557 (tmem258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  138626557 NCBI-ProteinID:  XP_069564384 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaactcgaggccatgaccagatacaccagcccggtgaacccggctgtgttcccccac ctcaccgtggtcctgctggccatcggcatgttcttcaccgcctggttcttcgtctatgag gtgacatcaacaaaatacaccagggacgtctacaaagagctgctgatctccctcgtggct tcacttttcatggggttcggtgtgctcttcttactactgtgggttggcatctacgtatga

DBGET integrated database retrieval system