Bufo gargarizans (Asiatic toad): 122923898 Help Entry 122923898         CDS       T07965                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism bgar  Bufo gargarizans (Asiatic toad) Pathway bgar04060   Cytokine-cytokine receptor interaction bgar04672   Intestinal immune network for IgA production bgar04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:bgar00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122923898 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     122923898 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     122923898 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bgar04052]     122923898 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:bgar00536]     122923898 (CXCL12) Cytokines and neuropeptides [BR:bgar04052]  Cytokines   Chemokines    122923898 (CXCL12) Glycosaminoglycan binding proteins [BR:bgar00536]  Heparan sulfate / Heparin   Chemokines    122923898 (CXCL12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  122923898 NCBI-ProteinID:  XP_044130691 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MDMRNLAFLTLLLAVFCFSEEKPVSLTYRCPCRYFESNVAKSNIKHLKILSTTNCSLQIV ARLKHNGKQICLDPKIKWIQEYLDKALNK NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggatatgaggaacctcgctttccttaccctactgcttgcggttttctgtttctctgaa gagaaaccagtcagcttgacttaccgatgtccctgtagatattttgaaagtaacgtggcc aagagcaacatcaaacacctgaagattctgtccaccaccaactgctctctgcagattgtg gctcgtcttaagcataatggaaaacagatttgcttggaccctaagattaagtggatccaa gagtacctggataaagctttgaacaagtaa

DBGET integrated database retrieval system