Bufo gargarizans (Asiatic toad): 122928017 Help Entry 122928017         CDS       T07965                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism bgar  Bufo gargarizans (Asiatic toad) Pathway bgar04010   MAPK signaling pathway bgar04510   Focal adhesion bgar04517   IgSF CAM signaling bgar04520   Adherens junction Brite KEGG Orthology (KO) [BR:bgar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122928017 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     122928017 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     122928017 (RAP1B)    04520 Adherens junction     122928017 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bgar04147]     122928017 (RAP1B)    04031 GTP-binding proteins [BR:bgar04031]     122928017 (RAP1B) Exosome [BR:bgar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122928017 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    122928017 (RAP1B)   Exosomal proteins of colorectal cancer cells    122928017 (RAP1B) GTP-binding proteins [BR:bgar04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     122928017 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  122928017 NCBI-ProteinID:  XP_044136390 LinkDB All DBs Position 2:308592017..308660364 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatacaagctagttgtcctgggctcaggtggtgtcgggaagtcagcgctgact gtccagtttgtccaaggaatttttgtcgaaaaatatgaccccacaatagaagactcttac agaaagcaagttgaagttgacggccaacaatgtatgctcgaaattttagacactgcagga acggaacaattcacagcaatgcgtgatctttatatgaagaatgggcaaggctttgcatta gtgtactctataactgcacagtctacatttaatgatttacaggacctcagagaacagatc ctccgagtcaaagacactgatgatgtgccaatgatattggttgggaacaaatgtgacttg gaagacgaaagggttgttggcaaggaacaggggcagaatctagcaagacagtggaacaat tgtgcattcctggagtcttctgccaagtccaagattaatgtcaacgagattttttatgat cttgtgcgacaaataaacagaaaaactcctgtaccgggcaaggcacgtaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system