KEGG   Blastomyces gilchristii: BDBG_08235
Entry
BDBG_08235        CDS       T06540                                 
Name
(RefSeq) cytochrome P450 55A3, variant
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
bgh  Blastomyces gilchristii
Pathway
bgh00910  Nitrogen metabolism
bgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgh00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BDBG_08235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bgh00199]
    BDBG_08235
Enzymes [BR:bgh01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     BDBG_08235
Cytochrome P450 [BR:bgh00199]
 Cytochrome P450, fungi type
  CYP55 family
   BDBG_08235
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 8501785
NCBI-ProteinID: XP_002621204
LinkDB
Position
Unknown
AA seq 462 aa
MMESQFARIAWSRSVERASSKSVMTPGSRSLRGLCISCRSRPLNSTRLSIVARTQRSNMS
TEATPPKFPFSRPSGAIPPLEYAKLRATNPISRVTLWDNSQPWLVVKYKDICSVLTDQRL
SKERTRAGFPEMNAGGKEAAKNRPTFVDMDPPDHGRQRSMVASLFTREHAETIRPHIQAT
ADTLLDEMIKKGCEKPVDLVPNFALPLPSYIIYGMLGVPKEDLEYLTQCNAVRSNGSSTA
AAASNANKELLDYIGNLTDKRLENPGQDMISKLVVEQLKPGHIDRLDAIQIAFLMLVAGN
ATLVNMISLGVVTLLQHPEQLADLKANPSLAPKFVEELCRFHTASAMATRRVAKEDIMLG
GHLIKAGEGIIAATQSGNRDEDVFPDPDVFNMHRQRGSELALGYGYGEHVCVAEGLARTE
LEVVFSTLFQRLPNLKLGIPLSEVKYSPPDGDVGITELPVVW
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgatggagtcgcagtttgctaggatagcttggtcccgttcagtggagagagcatcatcc
aaatcagtcatgaccccgggatctcgatcgttgagagggctatgcatatcctgcagatcc
agaccacttaattctactcgattatccattgtcgcgcgaacccaacgttccaacatgtct
acggaggccactcctccaaaattccccttctctcgcccatctggagctattcccccactg
gaatatgcgaagctgagagccacgaaccccatttctagagttactctttgggataacagt
caaccatggcttgtagtcaagtacaaggatatctgcagcgttcttacggaccagcgcctg
tcaaaggaacgaacacgcgctgggttcccagaaatgaatgctggagggaaagaggctgct
aaaaaccgcccaacatttgtagatatggaccctccagaccacgggcgtcagaggagcatg
gttgcttcacttttcaccagggagcatgctgagacgattcggccacatatccaagccacg
gctgacactcttctcgatgaaatgataaagaagggttgtgagaagcctgtagatttggtc
ccaaattttgctctaccgctaccatcatacataatatatgggatgctgggtgtgccgaaa
gaagatctcgaatatctcacccaatgtaacgccgtccgtagcaatggaagttccaccgct
gcagctgcatctaatgctaataaagagcttctggactacatcggcaacttgactgataaa
cggcttgaaaacccaggacaggacatgattagcaagcttgtcgtggaacagctcaaacct
ggccacattgaccgattggatgccatacaaatcgcctttttgatgcttgttgccggaaat
gccactctggtgaacatgatatcgcttggcgtcgtcactcttctccaacatcccgagcaa
ttggcagacctcaaagccaatccatctctcgcgcccaaatttgttgaagaactctgccgc
ttccacacggcatcagcgatggccacgaggcgggttgcgaaggaggacatcatgcttggc
ggtcatctcatcaaagcaggcgagggaataattgctgccacccaatccggcaaccgagat
gaagatgtcttcccagacccagatgtcttcaatatgcaccgccagcgcggttctgagcta
gctctaggttacggatacggtgaacatgtgtgtgtcgctgagggactggctcgaactgag
cttgaagttgttttctcaacgctattccaacgactaccaaacttgaagcttgggatccca
ctatctgaggtcaagtattctccaccagatggtgatgttggcatcacggagctgcctgtg
gtttggtaa

DBGET integrated database retrieval system