Blastomyces gilchristii: BDBG_08548 Help Entry BDBG_08548        CDS       T06540                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bgh  Blastomyces gilchristii Pathway bgh03420   Nucleotide excision repair bgh04111   Cell cycle - yeast bgh04120   Ubiquitin mediated proteolysis bgh04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bgh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     BDBG_08548    04120 Ubiquitin mediated proteolysis     BDBG_08548   09124 Replication and repair    03420 Nucleotide excision repair     BDBG_08548  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     BDBG_08548  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bgh04121]     BDBG_08548    03400 DNA repair and recombination proteins [BR:bgh03400]     BDBG_08548 Enzymes [BR:bgh01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      BDBG_08548 Ubiquitin system [BR:bgh04121]  Ubiquitin ligases (E3)   UBL E3 ligases    BDBG_08548   Multi subunit type E3    SCF complex     Ring finger protein      BDBG_08548    Cul2 complex      BDBG_08548    Cul3 complex      BDBG_08548    Cul4 complex      BDBG_08548    Cul7 complex      BDBG_08548    Cul8 complex      BDBG_08548    Cul9 complex      BDBG_08548 DNA repair and recombination proteins [BR:bgh03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       BDBG_08548     TCR (transcription coupled repair) factors      Cul4-CSA complex       BDBG_08548 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 PHD_NSD Motif Other DBs NCBI-GeneID:  8501657 NCBI-ProteinID:  XP_002621176 UniProt:  A0A179UYZ9 LinkDB All DBs Position Unknown AA seq 125 aa AA seqDB search MADVEMKDAAPSASGKSKAVARGGKSALSEAKGDAKKRFEVKKWNAVALWAWDIVVDNCA ICRNHIMDLCIECQANQGSSTTEECTVAWGICNHAFHFHCISRWLRTRQVCPLDNRDWEF QKYGR NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggccgacgtcgaaatgaaagatgctgcccccagtgcttctgggaagtcaaaagctgtt gctagaggaggaaaatcagctctcagtgaggctaaaggagatgcaaagaaacgctttgag gtgaagaagtggaatgccgttgcactgtgggcgtgggatatcgtcgtggataactgtgcc atttgcagaaaccatattatggatctatgtatcgaatgccaggcaaaccaaggctcatcc acgacagaggaatgcactgttgcttgggggatttgtaaccatgcgttccacttccactgc atttcgagatggttgagaacccgacaagtgtgcccgctagataacagagattgggagttc cagaaatacggacgatag

DBGET integrated database retrieval system