Brenneria goodwinii: AWC36_00140 Help Entry AWC36_00140       CDS       T05061                                  Name (GenBank) hypothetical protein   KO K05919   superoxide reductase [EC:1.15.1.2] Organism bgj  Brenneria goodwinii Brite KEGG Orthology (KO) [BR:bgj00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     AWC36_00140 Enzymes [BR:bgj01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.2  superoxide reductase      AWC36_00140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Desulfoferrodox Motif Other DBs NCBI-ProteinID:  ATA26823 UniProt:  A0AAE8EL94 LinkDB All DBs Position complement(30782..31018) Genome browser AA seq 78 aa AA seqDB search MDGEHHLEWIYLYTFRGGQIKFIAPGDKPSAIFSLAESDAYVYCDRAVCKGSQCKFNCKR GFTAYAYCNRHGLWKNMF NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggacggtgaacatcatctggaatggatttatctctacacattccggggcgggcaaatc aaattcatcgcgccgggcgacaagccttcagcgatcttttcgctggcggaaagcgatgcc tacgtctattgcgaccgcgcggtatgcaaaggcagccagtgcaagtttaactgcaaacgg ggattcaccgcctacgcatattgcaaccggcacggcctgtggaaaaacatgttttag

DBGET integrated database retrieval system