Benincasa hispida (wax gourd): 120071482 Help Entry 120071482         CDS       T07258                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bhj  Benincasa hispida (wax gourd) Pathway bhj03420   Nucleotide excision repair bhj04120   Ubiquitin mediated proteolysis bhj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bhj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120071482    04120 Ubiquitin mediated proteolysis     120071482   09124 Replication and repair    03420 Nucleotide excision repair     120071482  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bhj04121]     120071482    03400 DNA repair and recombination proteins [BR:bhj03400]     120071482 Enzymes [BR:bhj01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      120071482 Ubiquitin system [BR:bhj04121]  Ubiquitin ligases (E3)   UBL E3 ligases    120071482   Multi subunit type E3    SCF complex     Ring finger protein      120071482    Cul2 complex      120071482    Cul3 complex      120071482    Cul4 complex      120071482    Cul7 complex      120071482    Cul8 complex      120071482    Cul9 complex      120071482 DNA repair and recombination proteins [BR:bhj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       120071482     TCR (transcription coupled repair) factors      Cul4-CSA complex       120071482 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  120071482 NCBI-ProteinID:  XP_038879722 LinkDB All DBs Position 2:48791168..48792867 Genome browser AA seq 117 aa AA seqDB search MATLDTDVPMVPAGEASSSAGPSSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggctactttggataccgatgttcctatggttcccgccggcgaggcttcaagcagtgct ggcccttcgtcttccaaaaaacctaagcgattcgagatcaaaaagtggaatgctgtcgct ctctgggcttgggatattgttgtcgataactgtgcaatttgtaggaatcacataatggat ctttgtattgaatgtcaggcgaatcaagcgagtgctactagtgaggaatgtactgtcgcc tggggggtatgcaaccatgcttttcacttccactgcattagtcgttggttgaagactcgc caagtttgtccattggataatagtgaatgggagttccagaagtatggacattag

DBGET integrated database retrieval system