Bombus huntii (Hunt bumble bee): 126865323 Help Entry 126865323         CDS       T10446                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism bhun  Bombus huntii (Hunt bumble bee) Pathway bhun00510   N-Glycan biosynthesis bhun00513   Various types of N-glycan biosynthesis bhun04141   Protein processing in endoplasmic reticulum Module bhun_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:bhun00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     126865323    00513 Various types of N-glycan biosynthesis     126865323  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     126865323 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 CAAD TctB Pox_E2-like Motif Other DBs NCBI-GeneID:  126865323 NCBI-ProteinID:  XP_050473721 LinkDB All DBs Position 1:complement(10290561..10291960) Genome browser AA seq 80 aa AA seqDB search MVEIESMTRYVSPINPAIFPLLAVVLLGIGIFFTAWFFVYEVTSTKFTRDMFKELLISLV AAIFSGFGILFLLLWVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggtggaaatcgagtctatgacaagatatgtctctcccataaatcctgcaatttttcca ttactggcagtggtgttactaggaattggaatattctttacagcatggttctttgtttat gaagttactagcacaaaatttacaagggacatgtttaaagaattattaatctctctagta gcagcaatattttctggttttggtatattatttttactcctttgggttggaatttatgta tag

DBGET integrated database retrieval system