Bidens hawaiensis: 143629579 Help Entry 143629579         CDS       T11418                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism bhw  Bidens hawaiensis Pathway bhw03420   Nucleotide excision repair bhw04120   Ubiquitin mediated proteolysis bhw04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bhw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     143629579    04120 Ubiquitin mediated proteolysis     143629579   09124 Replication and repair    03420 Nucleotide excision repair     143629579  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bhw04121]     143629579    03400 DNA repair and recombination proteins [BR:bhw03400]     143629579 Enzymes [BR:bhw01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      143629579 Ubiquitin system [BR:bhw04121]  Ubiquitin ligases (E3)   UBL E3 ligases    143629579   Multi subunit type E3    SCF complex     Ring finger protein      143629579    Cul2 complex      143629579    Cul3 complex      143629579    Cul4 complex      143629579    Cul7 complex      143629579    Cul8 complex      143629579    Cul9 complex      143629579 DNA repair and recombination proteins [BR:bhw03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       143629579     TCR (transcription coupled repair) factors      Cul4-CSA complex       143629579 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  143629579 NCBI-ProteinID:  XP_076954932 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MDSDVTMVPAGDSSSLPGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggattccgacgtaacgatggttcccgccggtgactcctcgagtcttcccggaccttct tcgaagaaaccgaagcgtttcgaaatcaaaaagtggaacgccgttgctctgtgggcctgg gatattgtggttgataactgtgccatctgtaggaatcacatcatggatctgtgtattgag tgccaagctaatcaggctagtgctactagtgaggagtgtactgttgcttggggtgtctgc aaccatgcctttcatttccactgcattagccgttggctgaaaacacgtcaagtttgccct ctagataacagcgaatgggagtttcaaaaatacggtcactga

DBGET integrated database retrieval system