Bos indicus (zebu cattle): 109558719 Help Entry 109558719         CDS       T04792                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism biu  Bos indicus (zebu cattle) Pathway biu03050   Proteasome biu04060   Cytokine-cytokine receptor interaction biu04066   HIF-1 signaling pathway biu04217   Necroptosis biu04350   TGF-beta signaling pathway biu04380   Osteoclast differentiation biu04612   Antigen processing and presentation biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu04657   IL-17 signaling pathway biu04658   Th1 and Th2 cell differentiation biu04659   Th17 cell differentiation biu04660   T cell receptor signaling pathway biu04940   Type I diabetes mellitus biu05140   Leishmaniasis biu05142   Chagas disease biu05143   African trypanosomiasis biu05144   Malaria biu05145   Toxoplasmosis biu05146   Amoebiasis biu05152   Tuberculosis biu05160   Hepatitis C biu05164   Influenza A biu05168   Herpes simplex virus 1 infection biu05200   Pathways in cancer biu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer biu05321   Inflammatory bowel disease biu05322   Systemic lupus erythematosus biu05323   Rheumatoid arthritis biu05330   Allograft rejection biu05332   Graft-versus-host disease biu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     109558719 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     109558719 (IFNG)    04630 JAK-STAT signaling pathway     109558719 (IFNG)    04066 HIF-1 signaling pathway     109558719 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109558719 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109558719 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     109558719 (IFNG)    04612 Antigen processing and presentation     109558719 (IFNG)    04660 T cell receptor signaling pathway     109558719 (IFNG)    04658 Th1 and Th2 cell differentiation     109558719 (IFNG)    04659 Th17 cell differentiation     109558719 (IFNG)    04657 IL-17 signaling pathway     109558719 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     109558719 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109558719 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109558719 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     109558719 (IFNG)    05164 Influenza A     109558719 (IFNG)    05168 Herpes simplex virus 1 infection     109558719 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     109558719 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     109558719 (IFNG)    05144 Malaria     109558719 (IFNG)    05145 Toxoplasmosis     109558719 (IFNG)    05140 Leishmaniasis     109558719 (IFNG)    05142 Chagas disease     109558719 (IFNG)    05143 African trypanosomiasis     109558719 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     109558719 (IFNG)    05323 Rheumatoid arthritis     109558719 (IFNG)    05321 Inflammatory bowel disease     109558719 (IFNG)    05330 Allograft rejection     109558719 (IFNG)    05332 Graft-versus-host disease     109558719 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109558719 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109558719 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:biu03051]     109558719 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109558719 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:biu00536]     109558719 (IFNG) Proteasome [BR:biu03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     109558719 (IFNG) Cytokines and neuropeptides [BR:biu04052]  Cytokines   Interferons    109558719 (IFNG) Glycosaminoglycan binding proteins [BR:biu00536]  Heparan sulfate / Heparin   Cytokines    109558719 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma API5 DnaGprimase_HBD rva_4 Motif Other DBs NCBI-GeneID:  109558719 NCBI-ProteinID:  XP_019815611 UniProt:  A0A6P5BEK7 LinkDB All DBs Position 5:49372388..49377207 Genome browser AA seq 166 aa AA seqDB search MKYTSYFLALLLCXLLGFSGSYGQGQFFREIENLKEYFNASSPDVAKGGPLFSEILKNWK DESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQ IPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaatatacaagctatttcttagctttactgctctgtgkgcttttgggtttttctggt tcttatggccagggccaattttttagagaaatagaaaacttaaaggagtattttaatgca agtagcccagatgtagctaagggtgggcctctcttctcagaaattttgaagaattggaaa gatgaaagtgacaaaaaaattattcagagccaaattgtctccttctacttcaaactcttt gaaaacctcaaagataaccaggtcattcaaaggagcatggatatcatcaagcaagacatg tttcagaagttcttgaatggcagctctgagaaactggaggacttcaaaaagctgattcaa attccggtggatgatctgcagatccagcgcaaagccataaatgaactcatcaaagtgatg aatgacctgtcrccaaaatctaacctcagaaagcggaagagaagtcagaatctctttcga ggccggagagcatcaatgtaa

DBGET integrated database retrieval system