Bos indicus (zebu cattle): 109559248 Help Entry 109559248         CDS       T04792                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism biu  Bos indicus (zebu cattle) Pathway biu04010   MAPK signaling pathway biu04014   Ras signaling pathway biu04015   Rap1 signaling pathway biu04024   cAMP signaling pathway biu04062   Chemokine signaling pathway biu04510   Focal adhesion biu04520   Adherens junction biu04611   Platelet activation biu04670   Leukocyte transendothelial migration biu04720   Long-term potentiation biu04722   Neurotrophin signaling pathway biu04934   Cushing syndrome biu04972   Pancreatic secretion biu05211   Renal cell carcinoma biu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109559248 (RAP1B)    04014 Ras signaling pathway     109559248 (RAP1B)    04015 Rap1 signaling pathway     109559248 (RAP1B)    04024 cAMP signaling pathway     109559248 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     109559248 (RAP1B)    04520 Adherens junction     109559248 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     109559248 (RAP1B)    04670 Leukocyte transendothelial migration     109559248 (RAP1B)    04062 Chemokine signaling pathway     109559248 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     109559248 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     109559248 (RAP1B)    04722 Neurotrophin signaling pathway     109559248 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     109559248 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109559248 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     109559248 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109559248 (RAP1B)    04031 GTP-binding proteins [BR:biu04031]     109559248 (RAP1B) Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109559248 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    109559248 (RAP1B)   Exosomal proteins of colorectal cancer cells    109559248 (RAP1B) GTP-binding proteins [BR:biu04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     109559248 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  109559248 NCBI-ProteinID:  XP_019816410 UniProt:  A0A6P5BT62 LinkDB All DBs Position 5:complement(48829537..48873747) Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctctggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcttggatactgcagga acggaacaattcacagcaatgagggatttgtacatgaaaaatggacaaggctttgcgtta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagata cttcgagttaaagacacggatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcgacaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcgtca tgtcagctgctttaa

DBGET integrated database retrieval system