Bos indicus (zebu cattle): 109559308 Help Entry 109559308         CDS       T04792                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism biu  Bos indicus (zebu cattle) Pathway biu01522   Endocrine resistance biu04110   Cell cycle biu04115   p53 signaling pathway biu04151   PI3K-Akt signaling pathway biu04218   Cellular senescence biu04530   Tight junction biu04660   T cell receptor signaling pathway biu04933   AGE-RAGE signaling pathway in diabetic complications biu04934   Cushing syndrome biu05160   Hepatitis C biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05166   Human T-cell leukemia virus 1 infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05169   Epstein-Barr virus infection biu05200   Pathways in cancer biu05203   Viral carcinogenesis biu05212   Pancreatic cancer biu05214   Glioma biu05218   Melanoma biu05219   Bladder cancer biu05220   Chronic myeloid leukemia biu05222   Small cell lung cancer biu05223   Non-small cell lung cancer biu05224   Breast cancer biu05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     109559308 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     109559308 (CDK4)    04115 p53 signaling pathway     109559308 (CDK4)    04218 Cellular senescence     109559308 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     109559308 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     109559308 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109559308 (CDK4)    05203 Viral carcinogenesis     109559308 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     109559308 (CDK4)    05225 Hepatocellular carcinoma     109559308 (CDK4)    05214 Glioma     109559308 (CDK4)    05220 Chronic myeloid leukemia     109559308 (CDK4)    05218 Melanoma     109559308 (CDK4)    05219 Bladder cancer     109559308 (CDK4)    05224 Breast cancer     109559308 (CDK4)    05222 Small cell lung cancer     109559308 (CDK4)    05223 Non-small cell lung cancer     109559308 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109559308 (CDK4)    05160 Hepatitis C     109559308 (CDK4)    05164 Influenza A     109559308 (CDK4)    05162 Measles     109559308 (CDK4)    05163 Human cytomegalovirus infection     109559308 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     109559308 (CDK4)    05169 Epstein-Barr virus infection     109559308 (CDK4)    05165 Human papillomavirus infection     109559308 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     109559308 (CDK4)    04934 Cushing syndrome     109559308 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     109559308 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:biu01001]     109559308 (CDK4) Enzymes [BR:biu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      109559308 (CDK4) Protein kinases [BR:biu01001]  Serine/threonine kinases: CMGC group   CDK family    109559308 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  109559308 NCBI-ProteinID:  XP_019816493 UniProt:  A0A6P5BTD8 LinkDB All DBs Position 5:60024502..60027571 Genome browser AA seq 303 aa AA seqDB search MATSXYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG DAE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctccygatatgagccagtggctgagattggtgtcggtgcctatgggacagtg tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtaagagtcccc aatggaggaggtgctggagggggcctgcccatcagcaccgttcgggaggtggccttactg cggcgtctggaggcttttgagcatcccaatgttgtcaggcttatggacgtctgtgcaaca gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcatgtggaccaagatctc aggacatatctggacaaggcacccccaccaggcttgccagtggagaccataaaagatctg atgcgccaatttctaagaggcctggatttccttcatgccaactgcatcgttcaccgagac ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtat cgtgctccagaagttcttttgcagtctacgtatgcaacacccgtggacatgtggagcgtt ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct gaccagttaggcaaaatctttgacctgattggactgcccccagaggatgactggccccga gatgtctctctaccccgaggagccttttccccccgagggccccgcccagtgcagtcggtg gtccctgagctggaggagtctggagcacagctgctgctggagatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcactcttatctacacaaggcagaaggt gacgcagagtga

DBGET integrated database retrieval system