Bos indicus (zebu cattle): 109561213 Help Entry 109561213         CDS       T04792                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04630   JAK-STAT signaling pathway biu04640   Hematopoietic cell lineage biu04657   IL-17 signaling pathway biu04658   Th1 and Th2 cell differentiation biu04659   Th17 cell differentiation biu04660   T cell receptor signaling pathway biu04664   Fc epsilon RI signaling pathway biu04672   Intestinal immune network for IgA production biu05140   Leishmaniasis biu05200   Pathways in cancer biu05310   Asthma biu05320   Autoimmune thyroid disease biu05321   Inflammatory bowel disease biu05330   Allograft rejection Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109561213 (IL4)    04151 PI3K-Akt signaling pathway     109561213 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109561213 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     109561213 (IL4)    04660 T cell receptor signaling pathway     109561213 (IL4)    04658 Th1 and Th2 cell differentiation     109561213 (IL4)    04659 Th17 cell differentiation     109561213 (IL4)    04657 IL-17 signaling pathway     109561213 (IL4)    04664 Fc epsilon RI signaling pathway     109561213 (IL4)    04672 Intestinal immune network for IgA production     109561213 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109561213 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     109561213 (IL4)   09163 Immune disease    05310 Asthma     109561213 (IL4)    05320 Autoimmune thyroid disease     109561213 (IL4)    05321 Inflammatory bowel disease     109561213 (IL4)    05330 Allograft rejection     109561213 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109561213 (IL4)    00536 Glycosaminoglycan binding proteins [BR:biu00536]     109561213 (IL4) Cytokines and neuropeptides [BR:biu04052]  Cytokines   Interleukins    109561213 (IL4) Glycosaminoglycan binding proteins [BR:biu00536]  Heparan sulfate / Heparin   Cytokines    109561213 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  109561213 NCBI-ProteinID:  XP_019819163 UniProt:  A0A6P5C0Z5 LinkDB All DBs Position 7:complement(20484966..20492914) Genome browser AA seq 135 aa AA seqDB search MGLTSQLIPVLVCLLVCTSHFVHGHKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAP KNTTEKETFCRVGIELRRIYRSHXCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDL LERLKTIMKEKYSKC NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccagctgatcccagtgctggtctgcttactggtatgtaccagtcac ttcgtccatggacacaagtgtgatattaccttagcagagatcatcaaaacgctgaacatc ctcacaacgagaaagaattcatgcatggagctgcctgtagcagacgtctttgctgcccca aagaacacaactgagaaggaaaccttctgcagggttggaattgagcttaggcgtatctac aggagccacaygtgcttgaacaaattcctgggcggacttgacaggaatctcaacagcttg gcaagcaagacctgttctgtgaatgaagccaagacgagcacaagtacgctgaaagacctc ttggaaaggctaaagacgattatgaaggagaaatactccaagtgttga

DBGET integrated database retrieval system