Bos indicus (zebu cattle): 109562852 Help Entry 109562852         CDS       T04792                                  Name (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04217   Necroptosis biu04380   Osteoclast differentiation biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu04668   TNF signaling pathway biu04936   Alcoholic liver disease biu05135   Yersinia infection biu05142   Chagas disease biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease biu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109562852    04668 TNF signaling pathway     109562852    04151 PI3K-Akt signaling pathway     109562852   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109562852  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109562852  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109562852    04621 NOD-like receptor signaling pathway     109562852    04622 RIG-I-like receptor signaling pathway     109562852    04623 Cytosolic DNA-sensing pathway     109562852    04650 Natural killer cell mediated cytotoxicity     109562852   09158 Development and regeneration    04380 Osteoclast differentiation     109562852  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109562852    05161 Hepatitis B     109562852    05160 Hepatitis C     109562852    05171 Coronavirus disease     109562852    05164 Influenza A     109562852    05162 Measles     109562852    05168 Herpes simplex virus 1 infection     109562852    05163 Human cytomegalovirus infection     109562852    05167 Kaposi sarcoma-associated herpesvirus infection     109562852    05169 Epstein-Barr virus infection     109562852    05165 Human papillomavirus infection     109562852   09171 Infectious disease: bacterial    05135 Yersinia infection     109562852    05152 Tuberculosis     109562852   09174 Infectious disease: parasitic    05142 Chagas disease     109562852   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109562852   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     109562852  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109562852 Cytokines and neuropeptides [BR:biu04052]  Cytokines   Interferons    109562852 SSDB OrthologParalogGFIT Motif Pfam:  Interferon OrgA_MxiK NOMO_12th Motif Other DBs NCBI-GeneID:  109562852 NCBI-ProteinID:  XP_019821440 UniProt:  A0A6P5C793 LinkDB All DBs Position 8 Genome browser AA seq 186 aa AA seqDB search MTHRCLLQMVLLLCFSTTALPRSYSLLGLQERRSAAVSQKLLRQLPSTPQRCLEARMDFQ MPEEMKQAQQFQKEDAILVMYEMLQQIFGILTRDFSSTGWSETIIEDLLVELYGQMNRLQ PIQKEIMQKKNFTMGNTTVLHLKKYYLNLMYYLKSKEYNRCAWTVVRVQILTNFSFLKSL TAYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacccaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt cccaggagctacagcttgcttggattgcaagaaaggcggagtgctgcggtctctcagaaa ctcctgaggcagttaccttcaactcctcaacgttgcctcgaggccaggatggatttccag atgcctgaggagatgaagcaagcacagcagttccagaaggaagatgccatattggtcatg tatgagatgctccagcagatctttggcattcttaccagagatttctccagcactggctgg tctgagaccatcatcgaggacctccttgtggaactctatgggcagatgaatcgtctgcag ccaatccagaaggaaataatgcagaagaaaaacttcactatgggaaacacaaccgttctt cacctgaagaaatattacctcaacctcatgtactaccttaagtccaaggagtacaacagg tgtgcctggacagtcgtgcgagtgcaaatactcacgaacttttctttcctgaagagccta acagcttacctccgtgactga

DBGET integrated database retrieval system