Bos indicus (zebu cattle): 109570808 Help Entry 109570808         CDS       T04792                                  Symbol IL10 Name (RefSeq) interleukin-10   KO K05443   interleukin 10 Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04061   Viral protein interaction with cytokine and cytokine receptor biu04068   FoxO signaling pathway biu04148   Efferocytosis biu04625   C-type lectin receptor signaling pathway biu04630   JAK-STAT signaling pathway biu04660   T cell receptor signaling pathway biu04672   Intestinal immune network for IgA production biu05133   Pertussis biu05135   Yersinia infection biu05140   Leishmaniasis biu05142   Chagas disease biu05143   African trypanosomiasis biu05144   Malaria biu05145   Toxoplasmosis biu05146   Amoebiasis biu05150   Staphylococcus aureus infection biu05152   Tuberculosis biu05310   Asthma biu05320   Autoimmune thyroid disease biu05321   Inflammatory bowel disease biu05322   Systemic lupus erythematosus biu05330   Allograft rejection Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109570808 (IL10)    04068 FoxO signaling pathway     109570808 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109570808 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     109570808 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     109570808 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109570808 (IL10)    04660 T cell receptor signaling pathway     109570808 (IL10)    04672 Intestinal immune network for IgA production     109570808 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     109570808 (IL10)    05133 Pertussis     109570808 (IL10)    05150 Staphylococcus aureus infection     109570808 (IL10)    05152 Tuberculosis     109570808 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     109570808 (IL10)    05144 Malaria     109570808 (IL10)    05145 Toxoplasmosis     109570808 (IL10)    05140 Leishmaniasis     109570808 (IL10)    05142 Chagas disease     109570808 (IL10)    05143 African trypanosomiasis     109570808 (IL10)   09163 Immune disease    05310 Asthma     109570808 (IL10)    05322 Systemic lupus erythematosus     109570808 (IL10)    05320 Autoimmune thyroid disease     109570808 (IL10)    05321 Inflammatory bowel disease     109570808 (IL10)    05330 Allograft rejection     109570808 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109570808 (IL10)    00536 Glycosaminoglycan binding proteins [BR:biu00536]     109570808 (IL10) Cytokines and neuropeptides [BR:biu04052]  Cytokines   Interleukins    109570808 (IL10) Glycosaminoglycan binding proteins [BR:biu00536]  Heparan sulfate / Heparin   Cytokines    109570808 (IL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL10 IL22 Motif Other DBs NCBI-GeneID:  109570808 NCBI-ProteinID:  XP_019832543 UniProt:  A0A6P5D353 LinkDB All DBs Position 16:complement(3567730..3572510) Genome browser AA seq 179 aa AA seqDB search MPSSSALLCCLVFLAGVAASRDASTLSDSSCIHLPTSLPHMLRELRAAFGXVKTFFQMKD QLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPXAENHGPDIKEHVNSLGEKLKTL RLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYMTTKMQK NT seq 540 nt NT seq  +upstreamnt  +downstreamnt atgcccagcagctcagccctgctctgttgcctggtcttcctggctggggtggcagccagy cgagatgcgagcaccctgtctgacagcagctgtatccacttgccaaccagcctgccccac atgctgcgggagctccgagctgccttcggcarggtgaagactttctttcaaatgaaggac caactgcacagcttactgttgacccagtctctgctggatgactttaagggttacctgggt tgccaagccttgtcggaaatgatccagttttacctggaagaggtgatgccamaggctgag aaccacgggcctgacatcaaggagcacgtgaactcactgggggagaagctgaagaccctc cggctgcggctgcggcgctgtcatcgctttctgccctgcgaaaacaagagcaaggcggtg gagaaggtgaagagagtcttcagtgagctccaagagaggggtgtctacaaagccatgagt gagtttgacatcttcatcaactacatagaaacctacatgacaacgaagatgcaaaagtga

DBGET integrated database retrieval system