Bos indicus (zebu cattle): 109573916 Help Entry 109573916         CDS       T04792                                  Symbol ACTG1 Name (RefSeq) actin, cytoplasmic 2   KO K05692   actin beta/gamma 1 Organism biu  Bos indicus (zebu cattle) Pathway biu03082   ATP-dependent chromatin remodeling biu04015   Rap1 signaling pathway biu04145   Phagosome biu04210   Apoptosis biu04390   Hippo signaling pathway biu04510   Focal adhesion biu04520   Adherens junction biu04530   Tight junction biu04611   Platelet activation biu04613   Neutrophil extracellular trap formation biu04670   Leukocyte transendothelial migration biu04714   Thermogenesis biu04810   Regulation of actin cytoskeleton biu04814   Motor proteins biu04820   Cytoskeleton in muscle cells biu04919   Thyroid hormone signaling pathway biu04921   Oxytocin signaling pathway biu04971   Gastric acid secretion biu05014   Amyotrophic lateral sclerosis biu05100   Bacterial invasion of epithelial cells biu05132   Salmonella infection biu05135   Yersinia infection biu05164   Influenza A biu05205   Proteoglycans in cancer biu05225   Hepatocellular carcinoma biu05410   Hypertrophic cardiomyopathy biu05412   Arrhythmogenic right ventricular cardiomyopathy biu05414   Dilated cardiomyopathy biu05416   Viral myocarditis biu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     109573916 (ACTG1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     109573916 (ACTG1)    04390 Hippo signaling pathway     109573916 (ACTG1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     109573916 (ACTG1)   09143 Cell growth and death    04210 Apoptosis     109573916 (ACTG1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     109573916 (ACTG1)    04520 Adherens junction     109573916 (ACTG1)    04530 Tight junction     109573916 (ACTG1)   09142 Cell motility    04814 Motor proteins     109573916 (ACTG1)    04820 Cytoskeleton in muscle cells     109573916 (ACTG1)    04810 Regulation of actin cytoskeleton     109573916 (ACTG1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     109573916 (ACTG1)    04613 Neutrophil extracellular trap formation     109573916 (ACTG1)    04670 Leukocyte transendothelial migration     109573916 (ACTG1)   09152 Endocrine system    04921 Oxytocin signaling pathway     109573916 (ACTG1)    04919 Thyroid hormone signaling pathway     109573916 (ACTG1)   09154 Digestive system    04971 Gastric acid secretion     109573916 (ACTG1)   09159 Environmental adaptation    04714 Thermogenesis     109573916 (ACTG1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     109573916 (ACTG1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     109573916 (ACTG1)   09172 Infectious disease: viral    05164 Influenza A     109573916 (ACTG1)   09171 Infectious disease: bacterial    05132 Salmonella infection     109573916 (ACTG1)    05135 Yersinia infection     109573916 (ACTG1)    05100 Bacterial invasion of epithelial cells     109573916 (ACTG1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     109573916 (ACTG1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109573916 (ACTG1)    05410 Hypertrophic cardiomyopathy     109573916 (ACTG1)    05412 Arrhythmogenic right ventricular cardiomyopathy     109573916 (ACTG1)    05414 Dilated cardiomyopathy     109573916 (ACTG1)    05416 Viral myocarditis     109573916 (ACTG1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:biu03021]     109573916 (ACTG1)    03019 Messenger RNA biogenesis [BR:biu03019]     109573916 (ACTG1)    03036 Chromosome and associated proteins [BR:biu03036]     109573916 (ACTG1)    03029 Mitochondrial biogenesis [BR:biu03029]     109573916 (ACTG1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:biu04812]     109573916 (ACTG1)    04147 Exosome [BR:biu04147]     109573916 (ACTG1) Transcription machinery [BR:biu03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      109573916 (ACTG1) Messenger RNA biogenesis [BR:biu03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      109573916 (ACTG1) Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      109573916 (ACTG1)     NuA4 complex      109573916 (ACTG1)   Chromatin remodeling factors    BAF complex     109573916 (ACTG1)    PBAF complex     109573916 (ACTG1)    GBAF(ncBAF) complex     109573916 (ACTG1)    SWR1 complex     109573916 (ACTG1) Mitochondrial biogenesis [BR:biu03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     109573916 (ACTG1) Cytoskeleton proteins [BR:biu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      109573916 (ACTG1) Exosome [BR:biu04147]  Exosomal proteins   Proteins found in most exosomes    109573916 (ACTG1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  109573916 NCBI-ProteinID:  XP_019837062 UniProt:  A0A6P5DIN5 LinkDB All DBs Position 19:52750979..52753852 Genome browser AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaagaaattgccgccctcgtcatcgacaatggttctggcatgtgcaaagctggc tttgctggggatgacgccccccgggccgtgttcccgtccatcgttgggcgtccccgacac cagggcgtcatggtgggcatggggcagaaggacagctacgtgggcgacgaggcccagagc aagcgtggcatcctgacccttaagtaccccatcgagcacggcatcgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccccgaggag caccccgtgctgctgacggaggcccctctgaaccccaaggccaaccgtgagaagatgacc cagatcatgttcgagacgttcaacactcctgccatgtatgtggccatccaggctgtgctg tctctgtacgcctctggccgcaccactggcattgtcatggactctggggacggggtcacc cacacggtgcccatctacgaggggtacgccctcccccacgccatcctgcgtctggacctg gctggccgggacctgacagactacctcatgaagatcctcacggaacgtggttacagcttt accaccacagccgagcgggaaattgtgcgtgacatcaaggagaagctctgctacgtcgcc ctggacttcgagcaggagatggctacygctgcatcctcctcctccttggagaagagctat gagctgcccgatggtcaggtgatcaccattggcaatgagcggttccggtgtcccgaggca ctcttccagccgtccttcctgggtatggagtcctgtggcatccatgagaccaccttcaac tccatcatgaagtgtgacgtggacatccgaaaggacctgtatgccaacacggtgctgtct ggtgggaccaccatgtaccctggcatcgctgacaggatgcagaaggagatcaccgcgctg gctccaagcacgatgaagatcaagatcattgctcctccygagcgcaagtactcggtgtgg atcggaggctccatcctggcctccctgtccaccttccagcagatgtggatcagcaagcag gagtatgacgagtctggcccctccattgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system