Bos indicus (zebu cattle): 109574238 Help Entry 109574238         CDS       T04792                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism biu  Bos indicus (zebu cattle) Pathway biu01522   Endocrine resistance biu01524   Platinum drug resistance biu04010   MAPK signaling pathway biu04071   Sphingolipid signaling pathway biu04110   Cell cycle biu04115   p53 signaling pathway biu04137   Mitophagy - animal biu04151   PI3K-Akt signaling pathway biu04210   Apoptosis biu04211   Longevity regulating pathway biu04216   Ferroptosis biu04218   Cellular senescence biu04310   Wnt signaling pathway biu04722   Neurotrophin signaling pathway biu04919   Thyroid hormone signaling pathway biu05012   Parkinson disease biu05014   Amyotrophic lateral sclerosis biu05016   Huntington disease biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05165   Human papillomavirus infection biu05166   Human T-cell leukemia virus 1 infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05200   Pathways in cancer biu05202   Transcriptional misregulation in cancer biu05203   Viral carcinogenesis biu05205   Proteoglycans in cancer biu05206   MicroRNAs in cancer biu05210   Colorectal cancer biu05212   Pancreatic cancer biu05213   Endometrial cancer biu05214   Glioma biu05215   Prostate cancer biu05216   Thyroid cancer biu05217   Basal cell carcinoma biu05218   Melanoma biu05219   Bladder cancer biu05220   Chronic myeloid leukemia biu05222   Small cell lung cancer biu05223   Non-small cell lung cancer biu05224   Breast cancer biu05225   Hepatocellular carcinoma biu05226   Gastric cancer biu05230   Central carbon metabolism in cancer biu05417   Lipid and atherosclerosis biu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109574238 (TP53)    04310 Wnt signaling pathway     109574238 (TP53)    04071 Sphingolipid signaling pathway     109574238 (TP53)    04151 PI3K-Akt signaling pathway     109574238 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     109574238 (TP53)   09143 Cell growth and death    04110 Cell cycle     109574238 (TP53)    04210 Apoptosis     109574238 (TP53)    04216 Ferroptosis     109574238 (TP53)    04115 p53 signaling pathway     109574238 (TP53)    04218 Cellular senescence     109574238 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     109574238 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     109574238 (TP53)   09149 Aging    04211 Longevity regulating pathway     109574238 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109574238 (TP53)    05202 Transcriptional misregulation in cancer     109574238 (TP53)    05206 MicroRNAs in cancer     109574238 (TP53)    05205 Proteoglycans in cancer     109574238 (TP53)    05203 Viral carcinogenesis     109574238 (TP53)    05230 Central carbon metabolism in cancer     109574238 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     109574238 (TP53)    05212 Pancreatic cancer     109574238 (TP53)    05225 Hepatocellular carcinoma     109574238 (TP53)    05226 Gastric cancer     109574238 (TP53)    05214 Glioma     109574238 (TP53)    05216 Thyroid cancer     109574238 (TP53)    05220 Chronic myeloid leukemia     109574238 (TP53)    05217 Basal cell carcinoma     109574238 (TP53)    05218 Melanoma     109574238 (TP53)    05219 Bladder cancer     109574238 (TP53)    05215 Prostate cancer     109574238 (TP53)    05213 Endometrial cancer     109574238 (TP53)    05224 Breast cancer     109574238 (TP53)    05222 Small cell lung cancer     109574238 (TP53)    05223 Non-small cell lung cancer     109574238 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109574238 (TP53)    05161 Hepatitis B     109574238 (TP53)    05160 Hepatitis C     109574238 (TP53)    05162 Measles     109574238 (TP53)    05168 Herpes simplex virus 1 infection     109574238 (TP53)    05163 Human cytomegalovirus infection     109574238 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     109574238 (TP53)    05169 Epstein-Barr virus infection     109574238 (TP53)    05165 Human papillomavirus infection     109574238 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     109574238 (TP53)    05014 Amyotrophic lateral sclerosis     109574238 (TP53)    05016 Huntington disease     109574238 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109574238 (TP53)    05418 Fluid shear stress and atherosclerosis     109574238 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     109574238 (TP53)    01522 Endocrine resistance     109574238 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:biu03000]     109574238 (TP53)    03036 Chromosome and associated proteins [BR:biu03036]     109574238 (TP53)    03400 DNA repair and recombination proteins [BR:biu03400]     109574238 (TP53) Transcription factors [BR:biu03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     109574238 (TP53) Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      109574238 (TP53) DNA repair and recombination proteins [BR:biu03400]  Eukaryotic type   Check point factors    Other check point factors     109574238 (TP53) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P53 P53_tetramer P53_TAD DEC-1_N Motif Other DBs NCBI-GeneID:  109574238 NCBI-ProteinID:  XP_019837670 UniProt:  P67938 LinkDB All DBs Position 19:complement(27879659..27892060) Genome browser AA seq 386 aa AA seqDB search MEESQAELNVEPPLSQETFSDLWNLLPENNLLSSELSAPVDDLLPYTDVATWLDECPNEA PQMPEPSAPAAPPPATPAPATSWPLSSFVPSQKTYPGNYGFRLGFLQSGTAKSVTCTYSP SLNKLFCQLAKTCPVQLWVDSPPPPGTRVRAMAIYKKLEHMTEVVRRCPHHERSSDYSDG LAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYESPEIDSECTTIHYNFMCNSSCMGGMN RRPILTIITLEDSCGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGQSCPEPPPRSTKRA LPTNTSSSPQPKKKPLDGEYFTLQIRGFKRYEMFRELNDALELKDALDGREPGESRAHSS HLKSKKRPSPSCHKKPMLKREGPDSD NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt atggaagaatcacaggcagaactcaatgtggagccccctctgagtcaggagacattttcc gacttgtggaacctacttcctgaaaataaccttctgtcctccgagctctccgcacccgtg gatgacctgctcccgtacacagatgttgccacctggctggatgaatgtccgaatgaagcg ccccaaatgccagagccttctgccccagctgccccgccaccagccaccccagcaccagcc acctcctggcccctgtcgtcctttgtcccctcccagaagacctaccctggcaattacggt ttccgtctagggttcctgcaatccggaacagccaagtccgtgacctgcacgtattcccct tcccttaacaagctgttctgccagctggccaagacctgcccagtgcagctgtgggtcgac tcgccacccccgcccggcacccgcgtccgcgccatggccatctacaagaagttggagcac atgacggaggttgtgaggcgttgtccccaccatgagcgctcctctgactatagcgatggt ctggcccctcctcagcaccttatccgggtggaagggaatttacgcgcggagtatttggac gaccggaacacctttagacacagtgtggtggtgccctatgagtcccccgagatcgactct gagtgcaccaccatccactacaatttcatgtgtaacagctcctgcatggggggcatgaac cggcggcccatcctcaccatcatcacactggaagactcttgtggtaacctgctgggacgg aacagctttgaggtgcgtgtttgtgcctgtcctgggagagaccgccgcactgaggaagaa aatcttcgcaagaaggggcagtcttgccccgagccaccccctaggagcactaagcgagca ctgcctaccaacaccagctcctctccacagccaaagaagaaaccactggatggagagtac ttcactcttcagatccgtgggtttaaacgctatgagatgttccgagagctgaatgatgcc ttggagctgaaggatgctctggatggaagggaaccaggggaaagcagggctcactctagc cacctgaagtctaagaagaggccttctccctcctgccataaaaaaccaatgctcaagaga gagggacctgactcagactga

DBGET integrated database retrieval system