Bos javanicus (banteng): 133252538 Help Entry 133252538         CDS       T11659                                  Name (RefSeq) interferon beta-like   KO K05415   interferon beta Organism bjv  Bos javanicus (banteng) Pathway bjv04060   Cytokine-cytokine receptor interaction bjv04151   PI3K-Akt signaling pathway bjv04217   Necroptosis bjv04380   Osteoclast differentiation bjv04620   Toll-like receptor signaling pathway bjv04621   NOD-like receptor signaling pathway bjv04622   RIG-I-like receptor signaling pathway bjv04623   Cytosolic DNA-sensing pathway bjv04630   JAK-STAT signaling pathway bjv04650   Natural killer cell mediated cytotoxicity bjv04668   TNF signaling pathway bjv04936   Alcoholic liver disease bjv05135   Yersinia infection bjv05142   Chagas disease bjv05152   Tuberculosis bjv05160   Hepatitis C bjv05161   Hepatitis B bjv05162   Measles bjv05163   Human cytomegalovirus infection bjv05164   Influenza A bjv05165   Human papillomavirus infection bjv05167   Kaposi sarcoma-associated herpesvirus infection bjv05168   Herpes simplex virus 1 infection bjv05169   Epstein-Barr virus infection bjv05170   Human immunodeficiency virus 1 infection bjv05171   Coronavirus disease bjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     133252538    04668 TNF signaling pathway     133252538    04151 PI3K-Akt signaling pathway     133252538   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     133252538  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     133252538  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     133252538    04621 NOD-like receptor signaling pathway     133252538    04622 RIG-I-like receptor signaling pathway     133252538    04623 Cytosolic DNA-sensing pathway     133252538    04650 Natural killer cell mediated cytotoxicity     133252538   09158 Development and regeneration    04380 Osteoclast differentiation     133252538  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     133252538    05161 Hepatitis B     133252538    05160 Hepatitis C     133252538    05171 Coronavirus disease     133252538    05164 Influenza A     133252538    05162 Measles     133252538    05168 Herpes simplex virus 1 infection     133252538    05163 Human cytomegalovirus infection     133252538    05167 Kaposi sarcoma-associated herpesvirus infection     133252538    05169 Epstein-Barr virus infection     133252538    05165 Human papillomavirus infection     133252538   09171 Infectious disease: bacterial    05135 Yersinia infection     133252538    05152 Tuberculosis     133252538   09174 Infectious disease: parasitic    05142 Chagas disease     133252538   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     133252538   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     133252538  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bjv04052]     133252538 Cytokines and neuropeptides [BR:bjv04052]  Cytokines   Interferons    133252538 SSDB OrthologParalogGFIT Motif Pfam:  Interferon GAT Motif Other DBs NCBI-GeneID:  133252538 NCBI-ProteinID:  XP_061281164 LinkDB All DBs Position 8:23763592..23764804 Genome browser AA seq 185 aa AA seqDB search MTYRCLLQMVLLLCFSTTALSRSYSLLRFQQSQSLKKCQKLLGQLPSTQHCLEARMDFQM PEEMKQEQQFQKEDAILVMYEMLQHIFGILTRDFSSTGWSETIIEDLLEELYGQMNRLQP IQKEIMQKQNSTMGDTIGPHLGKYYFNLMQYLESKEYDRCAWTVVQVQILTNFSFLMRLT GYVRD NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt tccaggagctacagcttgcttcgattccaacaaagtcagagccttaaaaagtgtcagaaa ctcctggggcagttaccttcaactcaacattgcctcgaggccaggatggacttccagatg cctgaggagatgaagcaagaacagcagttccagaaggaagatgccatattggtcatgtat gagatgctccagcacatcttcggcattctcaccagagacttctccagcactggctggtct gagaccatcatcgaggacctccttgaggaactctatgggcagatgaatcgtctgcagcca atccagaaggaaataatgcagaagcaaaactccactatgggagacacgatcggtccccac ctagggaaatattacttcaacctcatgcagtacctggagtccaaggagtacgacaggtgt gcctggacagtcgtgcaagtgcaaatactcacgaacttttctttcctgatgagactaaca ggttatgtccgtgactga

DBGET integrated database retrieval system