Bos javanicus (banteng): 133253395 Help Entry 133253395         CDS       T11659                                  Name (RefSeq) interferon beta-2   KO K05415   interferon beta Organism bjv  Bos javanicus (banteng) Pathway bjv04060   Cytokine-cytokine receptor interaction bjv04151   PI3K-Akt signaling pathway bjv04217   Necroptosis bjv04380   Osteoclast differentiation bjv04620   Toll-like receptor signaling pathway bjv04621   NOD-like receptor signaling pathway bjv04622   RIG-I-like receptor signaling pathway bjv04623   Cytosolic DNA-sensing pathway bjv04630   JAK-STAT signaling pathway bjv04650   Natural killer cell mediated cytotoxicity bjv04668   TNF signaling pathway bjv04936   Alcoholic liver disease bjv05135   Yersinia infection bjv05142   Chagas disease bjv05152   Tuberculosis bjv05160   Hepatitis C bjv05161   Hepatitis B bjv05162   Measles bjv05163   Human cytomegalovirus infection bjv05164   Influenza A bjv05165   Human papillomavirus infection bjv05167   Kaposi sarcoma-associated herpesvirus infection bjv05168   Herpes simplex virus 1 infection bjv05169   Epstein-Barr virus infection bjv05170   Human immunodeficiency virus 1 infection bjv05171   Coronavirus disease bjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     133253395    04668 TNF signaling pathway     133253395    04151 PI3K-Akt signaling pathway     133253395   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     133253395  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     133253395  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     133253395    04621 NOD-like receptor signaling pathway     133253395    04622 RIG-I-like receptor signaling pathway     133253395    04623 Cytosolic DNA-sensing pathway     133253395    04650 Natural killer cell mediated cytotoxicity     133253395   09158 Development and regeneration    04380 Osteoclast differentiation     133253395  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     133253395    05161 Hepatitis B     133253395    05160 Hepatitis C     133253395    05171 Coronavirus disease     133253395    05164 Influenza A     133253395    05162 Measles     133253395    05168 Herpes simplex virus 1 infection     133253395    05163 Human cytomegalovirus infection     133253395    05167 Kaposi sarcoma-associated herpesvirus infection     133253395    05169 Epstein-Barr virus infection     133253395    05165 Human papillomavirus infection     133253395   09171 Infectious disease: bacterial    05135 Yersinia infection     133253395    05152 Tuberculosis     133253395   09174 Infectious disease: parasitic    05142 Chagas disease     133253395   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     133253395   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     133253395  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bjv04052]     133253395 Cytokines and neuropeptides [BR:bjv04052]  Cytokines   Interferons    133253395 SSDB OrthologParalogGFIT Motif Pfam:  Interferon P60-like PrlF_antitoxin Motif Other DBs NCBI-GeneID:  133253395 NCBI-ProteinID:  XP_061283022 LinkDB All DBs Position 8:23869976..23870925 Genome browser AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCFSTTALSRSYSLLRFQQRRSLAVCQKLLWQLPSTPQHCLEARMDFQ VPEEMNQAQQFRKEDAILVIYEMLQQIFGILTRDFSSTGWSETIIEDLLVELYGQMNRLQ PIQKEIMQKQNSTMGDTTVLHLRKYYFNLVQYLKSKEYNRCAWTVVRVQILRNFSFLTRL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt tccaggagctacagcttgcttcgattccaacaaaggcggagccttgcagtgtgtcagaaa ctcctgtggcagttaccttcaactcctcaacattgcctcgaggccaggatggacttccag gtccctgaggagatgaaccaagcacagcagttccggaaggaagatgccatattggtcatc tatgagatgctccagcagatctttggcattctcaccagagacttctccagcactggctgg tctgagaccatcatcgaggacctccttgtggaactctatgggcagatgaatcgtctgcag ccaatccagaaggaaataatgcagaagcaaaactccactatgggagacacgactgttctt cacctgaggaaatattacttcaacctcgtgcagtacctgaagtccaaggagtacaacagg tgtgcctggacagtcgtgagagtgcaaatactcaggaatttttctttcctgacgagacta acaggttacctccgtgactga

DBGET integrated database retrieval system