Bubalus kerabau (carabao): 129621813 Help Entry 129621813         CDS       T11435                                  Symbol FOS Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism bke  Bubalus kerabau (carabao) Pathway bke01522   Endocrine resistance bke04010   MAPK signaling pathway bke04024   cAMP signaling pathway bke04210   Apoptosis bke04380   Osteoclast differentiation bke04620   Toll-like receptor signaling pathway bke04657   IL-17 signaling pathway bke04658   Th1 and Th2 cell differentiation bke04659   Th17 cell differentiation bke04660   T cell receptor signaling pathway bke04662   B cell receptor signaling pathway bke04668   TNF signaling pathway bke04713   Circadian entrainment bke04725   Cholinergic synapse bke04728   Dopaminergic synapse bke04915   Estrogen signaling pathway bke04917   Prolactin signaling pathway bke04921   Oxytocin signaling pathway bke04926   Relaxin signaling pathway bke04928   Parathyroid hormone synthesis, secretion and action bke04932   Non-alcoholic fatty liver disease bke04935   Growth hormone synthesis, secretion and action bke05031   Amphetamine addiction bke05132   Salmonella infection bke05133   Pertussis bke05135   Yersinia infection bke05140   Leishmaniasis bke05142   Chagas disease bke05161   Hepatitis B bke05162   Measles bke05166   Human T-cell leukemia virus 1 infection bke05167   Kaposi sarcoma-associated herpesvirus infection bke05170   Human immunodeficiency virus 1 infection bke05171   Coronavirus disease bke05200   Pathways in cancer bke05207   Chemical carcinogenesis - receptor activation bke05208   Chemical carcinogenesis - reactive oxygen species bke05210   Colorectal cancer bke05224   Breast cancer bke05231   Choline metabolism in cancer bke05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bke05323   Rheumatoid arthritis bke05417   Lipid and atherosclerosis bke05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bke00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129621813 (FOS)    04668 TNF signaling pathway     129621813 (FOS)    04024 cAMP signaling pathway     129621813 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     129621813 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129621813 (FOS)    04660 T cell receptor signaling pathway     129621813 (FOS)    04658 Th1 and Th2 cell differentiation     129621813 (FOS)    04659 Th17 cell differentiation     129621813 (FOS)    04657 IL-17 signaling pathway     129621813 (FOS)    04662 B cell receptor signaling pathway     129621813 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     129621813 (FOS)    04917 Prolactin signaling pathway     129621813 (FOS)    04921 Oxytocin signaling pathway     129621813 (FOS)    04926 Relaxin signaling pathway     129621813 (FOS)    04935 Growth hormone synthesis, secretion and action     129621813 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     129621813 (FOS)   09156 Nervous system    04725 Cholinergic synapse     129621813 (FOS)    04728 Dopaminergic synapse     129621813 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     129621813 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     129621813 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129621813 (FOS)    05207 Chemical carcinogenesis - receptor activation     129621813 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     129621813 (FOS)    05231 Choline metabolism in cancer     129621813 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     129621813 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     129621813 (FOS)    05224 Breast cancer     129621813 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129621813 (FOS)    05170 Human immunodeficiency virus 1 infection     129621813 (FOS)    05161 Hepatitis B     129621813 (FOS)    05171 Coronavirus disease     129621813 (FOS)    05162 Measles     129621813 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     129621813 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     129621813 (FOS)    05135 Yersinia infection     129621813 (FOS)    05133 Pertussis     129621813 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     129621813 (FOS)    05142 Chagas disease     129621813 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     129621813 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     129621813 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129621813 (FOS)    05418 Fluid shear stress and atherosclerosis     129621813 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     129621813 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     129621813 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bke03000]     129621813 (FOS)    04131 Membrane trafficking [BR:bke04131]     129621813 (FOS) Transcription factors [BR:bke03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     129621813 (FOS) Membrane trafficking [BR:bke04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     129621813 (FOS) SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 CCDC110 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  129621813 NCBI-ProteinID:  XP_055394664 LinkDB All DBs Position 10:91503297..91506766 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDYCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLNGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSVGSMELKAEPFDDYMFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcatcctcctcccgctgcagcagcgcc tccccggccggggacagtctctcctactaccactcaccggccgactccttctccagcatg ggttctcccgtcaatgcgcaggactactgcaccgatctggccgtctccagtgccaacttc atcccaacagtgactgccatctcgaccagcccggacctacaatggctagtacagcccacc ctagtctcctccgtggccccgtcccagaccagagccccccacccctatggagtccctact ccctcagctggggcttactccagggctggagtcatgaaaaccatgacgggaggcagagct cagagcattggccggaggggcaaggtagaacagttgtccccagaagaagaagagaaaagg cgaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagggag ctgactgacaccctccaagcggagacagaccaactagaagatgagaagtcggctttgcag acagagattgccaatctgctgaaggagaaggaaaaactcgaattcatcctagcggctcac cgacctgcctgcaagatccccgacgacctgggcttcccagaagagatgtctgtggcttcc cttgatctgaatgggggcctgcctgaggctgccacccctgaatccgaggaggccttcacc ctgcccctcctcaatgaccctgagcccaagccctcagtggagcccgtcaagagcgtcggc agcatggagctgaaggctgagccctttgatgactacatgttcccagcatcgtccaggccc agcggctcggagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcatggtggctccctggggatggggcctatggccacggagctg gagcccctgtgcaccccagtggtcacctgtactcccagctgcactacttacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaacgagccttcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system