Bubalus kerabau (carabao): 129651251 Help Entry 129651251         CDS       T11435                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism bke  Bubalus kerabau (carabao) Pathway bke04010   MAPK signaling pathway bke04014   Ras signaling pathway bke04015   Rap1 signaling pathway bke04024   cAMP signaling pathway bke04062   Chemokine signaling pathway bke04510   Focal adhesion bke04517   IgSF CAM signaling bke04520   Adherens junction bke04611   Platelet activation bke04670   Leukocyte transendothelial migration bke04720   Long-term potentiation bke04722   Neurotrophin signaling pathway bke04934   Cushing syndrome bke04972   Pancreatic secretion bke05211   Renal cell carcinoma bke05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bke00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129651251 (RAP1B)    04014 Ras signaling pathway     129651251 (RAP1B)    04015 Rap1 signaling pathway     129651251 (RAP1B)    04024 cAMP signaling pathway     129651251 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     129651251 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     129651251 (RAP1B)    04520 Adherens junction     129651251 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     129651251 (RAP1B)    04670 Leukocyte transendothelial migration     129651251 (RAP1B)    04062 Chemokine signaling pathway     129651251 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     129651251 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     129651251 (RAP1B)    04722 Neurotrophin signaling pathway     129651251 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     129651251 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129651251 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     129651251 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bke04147]     129651251 (RAP1B)    04031 GTP-binding proteins [BR:bke04031]     129651251 (RAP1B) Exosome [BR:bke04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129651251 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    129651251 (RAP1B)   Exosomal proteins of colorectal cancer cells    129651251 (RAP1B) GTP-binding proteins [BR:bke04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     129651251 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  129651251 NCBI-ProteinID:  XP_055435937 LinkDB All DBs Position 1:77363688..77408366 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcgggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcctggatactgcagga acggaacaattcacagcaatgagggatttgtacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacacggatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcgacaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcgtca tgtcagctgctttaa

DBGET integrated database retrieval system