Bubalus kerabau (carabao): 129651528 Help Entry 129651528         CDS       T11435                                  Name (RefSeq) interferon beta-3   KO K05415   interferon beta Organism bke  Bubalus kerabau (carabao) Pathway bke04060   Cytokine-cytokine receptor interaction bke04151   PI3K-Akt signaling pathway bke04217   Necroptosis bke04380   Osteoclast differentiation bke04620   Toll-like receptor signaling pathway bke04621   NOD-like receptor signaling pathway bke04622   RIG-I-like receptor signaling pathway bke04623   Cytosolic DNA-sensing pathway bke04630   JAK-STAT signaling pathway bke04650   Natural killer cell mediated cytotoxicity bke04668   TNF signaling pathway bke04936   Alcoholic liver disease bke05135   Yersinia infection bke05142   Chagas disease bke05152   Tuberculosis bke05160   Hepatitis C bke05161   Hepatitis B bke05162   Measles bke05163   Human cytomegalovirus infection bke05164   Influenza A bke05165   Human papillomavirus infection bke05167   Kaposi sarcoma-associated herpesvirus infection bke05168   Herpes simplex virus 1 infection bke05169   Epstein-Barr virus infection bke05170   Human immunodeficiency virus 1 infection bke05171   Coronavirus disease bke05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bke00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     129651528    04668 TNF signaling pathway     129651528    04151 PI3K-Akt signaling pathway     129651528   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129651528  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     129651528  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129651528    04621 NOD-like receptor signaling pathway     129651528    04622 RIG-I-like receptor signaling pathway     129651528    04623 Cytosolic DNA-sensing pathway     129651528    04650 Natural killer cell mediated cytotoxicity     129651528   09158 Development and regeneration    04380 Osteoclast differentiation     129651528  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129651528    05161 Hepatitis B     129651528    05160 Hepatitis C     129651528    05171 Coronavirus disease     129651528    05164 Influenza A     129651528    05162 Measles     129651528    05168 Herpes simplex virus 1 infection     129651528    05163 Human cytomegalovirus infection     129651528    05167 Kaposi sarcoma-associated herpesvirus infection     129651528    05169 Epstein-Barr virus infection     129651528    05165 Human papillomavirus infection     129651528   09171 Infectious disease: bacterial    05135 Yersinia infection     129651528    05152 Tuberculosis     129651528   09174 Infectious disease: parasitic    05142 Chagas disease     129651528   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129651528   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     129651528  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bke04052]     129651528 Cytokines and neuropeptides [BR:bke04052]  Cytokines   Interferons    129651528 SSDB OrthologParalogGFIT Motif Pfam:  Interferon Phage_T4_Y06P Motif Other DBs NCBI-GeneID:  129651528 NCBI-ProteinID:  XP_055436194 LinkDB All DBs Position 4:88676325..88678191 Genome browser AA seq 186 aa AA seqDB search MTYRCLLPMVLLLCFSTTALSGSYSLLRFQQRRSAAVCQKLLGQLPSTPQHCLEARMDFQ VPEEMNQAQQFRKEDAILVIYEMLQQIVNILTRDFSSTGWSETIIEDLLVELYGQMNRLQ PIQKEIMQEQNFTMGDTTVLHLKKYYFNLVQYLESKEYNRCAWTVVQVQILTNFSFLTRL TAYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctcccgatggttctcctgctgtgtttctccaccacagctctt tccgggagctacagcttgctccgattccagcaaaggcggagcgctgcggtgtgtcagaaa ctcctggggcagttaccttcaacgcctcaacattgcctcgaggccaggatggacttccag gtccctgaggagatgaaccaagcacagcagttccggaaggaagatgccatattggtcatc tatgagatgctccagcagatcgtcaatattctcaccagagacttctccagcactggctgg tctgagaccatcattgaggacctccttgtggaactctatgggcagatgaatcgtctgcag ccaatccagaaggaaataatgcaggagcaaaacttcaccatgggggacacaaccgttctt cacctgaagaagtactacttcaacctcgtgcagtacctggagtccaaggagtacaacagg tgtgcctggacagtcgtgcaagtgcaaatactcacgaacttttctttcctgacgagacta acagcttacctccgtgactga

DBGET integrated database retrieval system