Bacillus licheniformis ATCC 14580: BL00862 Help Entry BL00862           CDS       T00197                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bli  Bacillus licheniformis ATCC 14580 Pathway bli00790   Folate biosynthesis bli01100   Metabolic pathways bli01240   Biosynthesis of cofactors Module bli_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bli00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BL00862 (folB) Enzymes [BR:bli01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BL00862 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BL00862 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BL00862 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB divDNAB Motif Other DBs NCBI-ProteinID:  AAU21726 UniProt:  Q65PE3 LinkDB All DBs Position 91401..91784 Genome browser AA seq 127 aa AA seqDB search MIKEAFIIDKVHVEGMEFYGYHGVFKEENKLGQRFRVDLTAFLDLSEAGKTDNIEATINY AELYKLCKEVVEGEPVNLVETLAETIAAQVLENFEAVQECTVKVVKPDPPIPGHYKSVAI EMTRKRK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt ttgataaaggaggcgtttatcatcgataaagtgcatgtagagggcatggagttttacgga tatcacggtgttttcaaagaagaaaacaaactcggccagagattccgcgttgatctgaca gcatttctagatttaagcgaagccgggaaaacggataatattgaggccaccattaattat gcagagctgtataagctgtgcaaagaggttgtggagggagagccggtcaaccttgtggag accctcgcggaaacgattgccgcacaagtgctggagaattttgaagcggttcaggaatgt acggttaaagtcgtcaagcctgatcctcctatacctgggcactataaatcggtggccatc gagatgacgagaaagcgaaaatga

DBGET integrated database retrieval system