KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_1424
Entry
BLJ_1424          CDS       T01240                                 
Name
(GenBank) DNA ligase, NAD-dependent
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll03030  DNA replication
bll03410  Base excision repair
bll03420  Nucleotide excision repair
bll03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bll00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BLJ_1424
   03410 Base excision repair
    BLJ_1424
   03420 Nucleotide excision repair
    BLJ_1424
   03430 Mismatch repair
    BLJ_1424
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bll03032]
    BLJ_1424
   03400 DNA repair and recombination proteins [BR:bll03400]
    BLJ_1424
Enzymes [BR:bll01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     BLJ_1424
DNA replication proteins [BR:bll03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     BLJ_1424
DNA repair and recombination proteins [BR:bll03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     BLJ_1424
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BLJ_1424
   MMR (mismatch excision repair)
    DNA ligase
     BLJ_1424
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BLJ_1424
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT DNA_ligase_ZBD HHH_5 HHH PTCB-BRCT Nlig-Ia BRCT_2 Seipin Zn_Ribbon_1
Other DBs
NCBI-ProteinID: ADH00868
UniProt: D6ZVG2
LinkDB
Position
complement(1681262..1684024)
AA seq 920 aa
MSTNEQLAWDFDDGDVAEVRPDTGIARFAPGSEQWIAALQPTDDDAIRLDRFDVNTMTAE
AAARLWARVAAWVESDQIAYYIDDSPVSSDAAYDARMRCLERLEAAFPSLDNPQSPTHRV
GGSFSNDFTSVRHPSRMMSLDDVFSIEELKDWYDSVIRDLDWPESKPLPMSCEVKIDGLA
LNLIYRNGVLEQGLTRGDGVTGEDITLNVRTIGSIPANLGGPKEDVPDFVEIRGEVFMRW
DDFHTLNNEQEDAGRAPFANPRNAAAGSLRQKDPRITATRRLSFYAHGLGQLTWGPDHPR
GTHDVVADQSQAYDLYTRWGVPVSPHNRAVTSFQEILDMIEYYGEHRGDIEHALDGIVVK
VDDLGLQRALGATSRAPRWAIAYKYPPEEVNTELLNITVQVGRTGRVTPVAVLKPVYVAG
STVARTTLHNGFEVKRKGILIGDTVVVRKAGDVIPELVGPVLERRKGREGQLREFVMPEF
CPSCGAKLAPAKEGDKDIRCPNVESCPAQLTERVISLASRKAFDIEHLGEQSAIALTNPE
ENRPDSVATYAPNITEVLVAPGEEPEPYEPVEGLELPAAQKPVLSNESGLFDLTSADLRD
VRVWREAAIVEVHETVDANGKKKKVRKRVGGSGLWHQVPAFWTAPTPAKKLTAKQLAERA
QEEAAVESAGTQGGAASETTGAPTGAEAPLGTMPGFAAASYPEYDVPADAVIVRVDHKTT
RTGVTDVPVIIRPGENTRKMFDEMDKARHADLWRVLVALSIRRLGPPTARLIASAMGSLA
AIENATIEDLTAIDGVGPEIAESVVNWFAAAREPGDWRGATLRAWQAAGVGVDEAETSSL
PQTLAGKTVVVTGSLEGYSRDSAKEAIIERGGKAAGSVSKKTDYVVIGANAGSKATKAEE
LGIPMLGEAQFAQLLATGTI
NT seq 2763 nt   +upstreamnt  +downstreamnt
atgagcacgaacgaacaactggcatgggatttcgacgatggggatgtggccgaggtccgg
cctgataccggtattgcacgttttgcccctggctccgaacaatggatagccgcactgcag
cccactgacgacgacgcgatacgcctcgaccgtttcgacgtgaacacgatgaccgctgag
gccgccgcccgcctgtgggctcgcgtggccgcatgggtggaatccgatcagatcgcctac
tacatcgacgactcacccgtcagctccgacgccgcctacgacgcgcgcatgcgttgcctc
gaacgactcgaagcggcgttcccctcattggacaatccgcagtcgcccacccatcgcgtc
ggcggctccttctccaacgacttcacctccgtgcgccaccccagccgcatgatgagcctt
gacgacgtcttctccatcgaagaactcaaggattggtacgactcggtgattcgcgacctc
gattggcccgaatccaagcccctgcccatgagctgcgaggtcaaaatcgacggcctcgcc
ctgaacctcatctatcgcaacggcgtgcttgaacagggcctgacgcgcggcgacggcgtt
accggcgaagacatcaccctgaatgtgcgaaccatcggctccattcccgccaacctcggc
ggccccaaggaagacgttccggacttcgtggaaatccgaggcgaagtgttcatgcgctgg
gatgacttccacaccctgaacaacgagcaggaggacgccggacgagcgccctttgccaac
ccgcgcaacgccgccgccggctcgctgcgtcaaaaagaccctcgcatcaccgccacccgt
cgcctgagcttctatgcgcatggtctgggtcagctcacctgggggccggaccatccgcgc
ggcacccatgacgtggtcgccgaccagtcgcaggcctacgatctatacaccaggtggggc
gtgccggtctccccgcataatcgtgcggtgacctcattccaggagatcctggacatgatc
gagtactacggcgagcatcgcggcgacatcgagcacgcgctcgacggcattgtcgtcaag
gtcgatgacctgggcctgcagcgcgccctcggtgccacctcgcgcgcgccgcgctgggcc
atcgcctacaaatacccgcccgaagaggtcaacaccgaactgctcaacatcaccgtgcag
gtggggcgtaccggccgtgtgacgccggtcgccgtgctcaaacctgtctacgtggccggc
tccaccgtggctcgtaccacgctgcacaacggatttgaagtcaaacgcaagggcatcctg
atcggcgacaccgtggtggtgcgcaaggccggcgatgtgattcccgaactggtcggcccg
gtgcttgaacggcgcaaagggcgtgagggccagctgcgcgaattcgtcatgcccgagttc
tgcccttcatgcggcgcgaaactggcacccgccaaggagggtgacaaggacatccgctgc
ccgaatgtggaaagctgcccggcccagttgaccgagcgcgtgatttcgctggcctcacgc
aaggcgttcgacatcgagcatctgggtgaacagtcggccatcgctctgaccaacccggag
gagaaccggcctgattcggtggcgacctacgcgccgaacatcactgaggttctggtcgcc
cccggcgaagagcccgaaccgtacgagccggtggaggggctggaattgccggccgcgcag
aagccggtgttgtctaacgaatccgggttgttcgacctgacctccgccgatctgcgcgac
gtgcgtgtgtggcgtgaggccgcaatcgtcgaagtgcatgagacggtcgatgcgaacggt
aagaagaaaaaggtgcgtaagcgtgtcggcggctctggcctgtggcatcaggtgcctgcc
ttctggaccgcgcccacgccggccaagaagcttacggccaagcagttggccgaacgcgcg
caagaagaggccgcagtcgaatctgccggaacacagggaggtgccgccagcgagacgacc
ggcgcacctaccggggctgaggctccacttggtactatgccgggctttgccgcagcctcc
tatcccgagtatgacgtgccggccgacgcggtcatcgtgcgcgtggaccacaagaccacg
cgcaccggcgtcacggatgtgccggtgatcattcggcccggcgaaaacacgcgcaagatg
ttcgacgaaatggacaaggcccgtcacgccgacctgtggcgtgtgctggtcgcgttgtcg
attcgccggctcggtccgcctaccgcacgcctgatcgcctcggcgatgggctcgctggca
gccatcgaaaacgccacgattgaagatctgacggccatcgacggggtgggcccggaaatc
gccgaatcggtggtgaactggttcgccgccgcccgcgagcccggcgactggcgcggcgcg
actttgcgtgcttggcaggccgccggcgtgggcgtcgacgaggccgagaccagttcgctg
ccgcagacgctggccggcaaaaccgtggtggtcaccggttctctggagggctattcgcgc
gactccgccaaagaggcgattatcgagcgcggcggcaaggcggccggttcggtgagcaag
aagaccgattacgtggtgatcggcgcaaacgccggctccaaggccaccaaggctgaggaa
ctcggcatccccatgctgggcgaagcccaattcgcccagctcctagccaccggcaccatc
taa

DBGET integrated database retrieval system