Bacillus megaterium WSH-002: BMWSH_1166 Help Entry BMWSH_1166        CDS       T01890                                  Symbol dfrA Name (GenBank) Dihydrofolate reductase region   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism bmh  Bacillus megaterium WSH-002 Pathway bmh00670   One carbon pool by folate bmh00790   Folate biosynthesis bmh01100   Metabolic pathways bmh01240   Biosynthesis of cofactors bmh04981   Folate transport and metabolism Module bmh_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bmh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BMWSH_1166 (dfrA)    00670 One carbon pool by folate     BMWSH_1166 (dfrA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     BMWSH_1166 (dfrA) Enzymes [BR:bmh01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      BMWSH_1166 (dfrA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 RibD_C Motif Other DBs NCBI-ProteinID:  AEN88050 UniProt:  A0A8D3WZB9 LinkDB All DBs Position 1201243..1201728 Genome browser AA seq 161 aa AA seqDB search MISLIVAMDQNRLIGKENDLPWRLPEDLKYFKRITTSHTIVMGRKTFESIGRPLPNRENV VLTRQKDYQQEGATVIHSVEELEALDAEKEDELFVIGGATLYEQTLDVANRLYITHIEES FEGDTHFPAVNLSEWRVISKQQGIKDEKNPYTYYFTVYERS NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgatttccctcattgtcgcaatggatcaaaataggctgatcggtaaagagaatgatttg ccatggcgtcttcccgaagatttaaagtatttcaagcgcatcacaacgagtcatacgatt gtaatgggaagaaaaacatttgaatcaattggacgaccgcttcctaatcgcgaaaatgtg gttcttacgcgtcaaaaagattatcaacaagaaggagcaaccgttattcattcagttgag gaactagaagcattagatgctgaaaaagaagacgagctgtttgtgattggtggagctact ctgtatgagcaaacattagacgttgcaaaccgactttatattacgcatattgaagaatcg tttgaaggagatacacattttcctgcggttaacctgagcgaatggagagttatttcgaag caacaaggaattaaagatgaaaaaaatccctacacgtattattttacagtatacgagcga agctaa

DBGET integrated database retrieval system