Bombyx mori (domestic silkworm): 101743309 Help Entry 101743309         CDS       T02817                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism bmor  Bombyx mori (domestic silkworm) Pathway bmor00510   N-Glycan biosynthesis bmor00513   Various types of N-glycan biosynthesis bmor04141   Protein processing in endoplasmic reticulum Module bmor_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:bmor00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     101743309    00513 Various types of N-glycan biosynthesis     101743309  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101743309 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 Pox_E2-like Pestivirus_E2 Motif Other DBs NCBI-GeneID:  101743309 NCBI-ProteinID:  XP_037867785 UniProt:  A0A8R2LUY7 LinkDB All DBs Position 6:2261297..2261892 Genome browser AA seq 81 aa AA seqDB search MSLEIESMIRYTSPINPAVFPHLTFLLLGIGIFFTAWFFVYEVTSTKASRDMFKELLLSL VAALFSGFGILFLLLWVGIYV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtctcgaaattgaatcaatgatccggtacacgtcgccaataaacccggcagttttt ccacatctaacctttttgttgctcggaataggaatattcttcacggcctggttcttcgtt tacgaagttacaagtactaaagcctcaagagatatgttcaaagagttacttttatcattg gtggccgccttattttctggtttcggaattttattcttgttgctatgggtagggatttat gtgtga

DBGET integrated database retrieval system