Bombyx mori (domestic silkworm): 692970 Help Entry 692970            CDS       T02817                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism bmor  Bombyx mori (domestic silkworm) Pathway bmor03008   Ribosome biogenesis in eukaryotes bmor03013   Nucleocytoplasmic transport bmor03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:bmor00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     692970    03008 Ribosome biogenesis in eukaryotes     692970   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     692970  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bmor03019]     692970    03009 Ribosome biogenesis [BR:bmor03009]     692970    03016 Transfer RNA biogenesis [BR:bmor03016]     692970    03036 Chromosome and associated proteins [BR:bmor03036]     692970   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bmor04147]     692970    04031 GTP-binding proteins [BR:bmor04031]     692970 Messenger RNA biogenesis [BR:bmor03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      692970 Ribosome biogenesis [BR:bmor03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     692970   Pre-60S particles     692970 Transfer RNA biogenesis [BR:bmor03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     692970 Chromosome and associated proteins [BR:bmor03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      692970    Spindle formation proteins     692970 Exosome [BR:bmor04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    692970 GTP-binding proteins [BR:bmor04031]  Small (monomeric) G-proteins   Ran Family    Ran     692970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RNA_helicase AAA_24 ArgoMid Gtr1_RagA AAA_7 AAA_16 Pox_A32 DUF5906 Motif Other DBs NCBI-GeneID:  692970 NCBI-ProteinID:  NP_001040274 UniProt:  Q2F5M1 LinkDB All DBs Position 10:5375977..5378001 Genome browser AA seq 213 aa AA seqDB search MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIRFNV WDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNK VDIKDRKVKAKTIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVAMPALL PPEVTMDPQWQNQIEKDLQDAQNTALPEEDEDL NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atggcagatgatatgcccacattcaagtgtgtattggtaggagatggtggtactggcaaa acaacctttgtcaaaagacatttgactggagagttcgagaaaaaatacgttgcgactctg ggtgtcgaagtacatcctctagtattccatacgaaccgcgggccaattcgttttaatgtg tgggacacagccggacaagagaagtttggtggtcttagagacggatactatattcaagga caatgtgctatcatcatgttcgacgtaacctctcgagttacgtacaaaaatgtacctaac tggcatagagatttggtccgtgtatgtgaaggtatccctattgtcttgtgcggaaacaaa gtggatattaaagacagaaaagttaaggcgaaaactattgttttccacaggaaaaagaat ttgcagtactacgacatttctgctaagtcaaactacaacttcgaaaaacccttcctgtgg ctagctagaaaattaattggtgacggtaaccttgagtttgttgccatgcctgcccttctg ccaccagaagttacaatggatcctcaatggcagaaccaaattgaaaaagatcttcaagat gcacaaaatactgctcttcctgaggaagatgaagacttataa

DBGET integrated database retrieval system