Priestia megaterium QM B1551: BMQ_4059 Help Entry BMQ_4059          CDS       T01208                                  Symbol dfrA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism bmq  Priestia megaterium QM B1551 Pathway bmq00670   One carbon pool by folate bmq00790   Folate biosynthesis bmq01100   Metabolic pathways bmq01240   Biosynthesis of cofactors bmq04981   Folate transport and metabolism Module bmq_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bmq00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BMQ_4059 (dfrA)    00670 One carbon pool by folate     BMQ_4059 (dfrA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     BMQ_4059 (dfrA) Enzymes [BR:bmq01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      BMQ_4059 (dfrA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 RibD_C Motif Other DBs NCBI-ProteinID:  ADE71071 UniProt:  D5DPX0 LinkDB All DBs Position complement(3894145..3894630) Genome browser AA seq 161 aa AA seqDB search MISLIVAMDQNRLIGKENDLPWRLPEDLKYFKRITTSHTIIMGRKTFESIGRPLPNRENV VLTRQKDYQQEGATVIHSVEELEALDAEKKDELFVIGGATLYEQTLGVANRLYITHIEES FEGDTHFPAIDLSEWKVISKQQGIKDEKNPYTYYFTVYERS NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgatttccctcattgtcgcaatggatcaaaacaggctgatcggtaaagaaaatgatttg ccatggcgtcttccggaagatttaaagtatttcaaacgcatcacaacgagtcataccatt ataatgggaagaaaaacatttgaatcaattggacgaccgctccctaatcgcgagaatgtg gttcttacgcgtcaaaaagattatcaacaagaaggagcaaccgttattcattcagttgag gaattagaagcattagatgctgaaaaaaaagacgagctgttcgtgattggcggagctact ctgtatgagcaaacattaggcgttgcaaaccgactttatattacgcatattgaagaatcc tttgaaggagatacacattttcctgcgattgatttgagcgaatggaaagttatttcgaag cagcaaggaattaaagatgaaaaaaatccctacacgtattattttaccgtatacgagcga agctga

DBGET integrated database retrieval system