Balaenoptera musculus (blue whale): 118890293 Help Entry 118890293         CDS       T09887                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus03083   Polycomb repressive complex bmus04010   MAPK signaling pathway bmus05200   Pathways in cancer bmus05202   Transcriptional misregulation in cancer bmus05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:bmus00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     118890293 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118890293 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118890293 (MAX)    05202 Transcriptional misregulation in cancer     118890293 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     118890293 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bmus03000]     118890293 (MAX)    03036 Chromosome and associated proteins [BR:bmus03036]     118890293 (MAX) Transcription factors [BR:bmus03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     118890293 (MAX) Chromosome and associated proteins [BR:bmus03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      118890293 (MAX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HLH JetA bZIP_2 bHLH_INO4 SlyX bHLH_INO2 SLX9 DUF7801 GAGA_bind Csm1_N Motif Other DBs NCBI-GeneID:  118890293 NCBI-ProteinID:  XP_036698835 UniProt:  A0A8B8WS14 LinkDB All DBs Position 2:complement(139446586..139469944) Genome browser AA seq 162 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKQQA SRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSS DNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcggtcccatcactccaaggagagaagcaacaggca tcccgggcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaac cacacacaccagcaagatattgatgacctcaagcggcagaatgctcttctggagcagcaa gtccgtgcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctca gacaacagcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctca gactccagctcggagtcggagcccgaagagccccaaagcaggaagaagctccggatggag gccagctaa

DBGET integrated database retrieval system