KEGG   Balaenoptera musculus (blue whale): 118892955
Entry
118892955         CDS       T09887                                 
Symbol
GNA11
Name
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
bmus  Balaenoptera musculus (blue whale)
Pathway
bmus04020  Calcium signaling pathway
bmus04022  cGMP-PKG signaling pathway
bmus04081  Hormone signaling
bmus04082  Neuroactive ligand signaling
bmus04270  Vascular smooth muscle contraction
bmus04540  Gap junction
bmus04725  Cholinergic synapse
bmus04730  Long-term depression
bmus04911  Insulin secretion
bmus04912  GnRH signaling pathway
bmus04925  Aldosterone synthesis and secretion
bmus04927  Cortisol synthesis and secretion
bmus04928  Parathyroid hormone synthesis, secretion and action
bmus04929  GnRH secretion
bmus04934  Cushing syndrome
bmus04935  Growth hormone synthesis, secretion and action
bmus05142  Chagas disease
bmus05146  Amoebiasis
bmus05163  Human cytomegalovirus infection
bmus05170  Human immunodeficiency virus 1 infection
bmus05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bmus00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    118892955 (GNA11)
   04022 cGMP-PKG signaling pathway
    118892955 (GNA11)
  09133 Signaling molecules and interaction
   04082 Neuroactive ligand signaling
    118892955 (GNA11)
   04081 Hormone signaling
    118892955 (GNA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    118892955 (GNA11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    118892955 (GNA11)
   04929 GnRH secretion
    118892955 (GNA11)
   04912 GnRH signaling pathway
    118892955 (GNA11)
   04935 Growth hormone synthesis, secretion and action
    118892955 (GNA11)
   04928 Parathyroid hormone synthesis, secretion and action
    118892955 (GNA11)
   04925 Aldosterone synthesis and secretion
    118892955 (GNA11)
   04927 Cortisol synthesis and secretion
    118892955 (GNA11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    118892955 (GNA11)
  09156 Nervous system
   04725 Cholinergic synapse
    118892955 (GNA11)
   04730 Long-term depression
    118892955 (GNA11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118892955 (GNA11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    118892955 (GNA11)
   05163 Human cytomegalovirus infection
    118892955 (GNA11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    118892955 (GNA11)
   05142 Chagas disease
    118892955 (GNA11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    118892955 (GNA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmus04147]
    118892955 (GNA11)
   04031 GTP-binding proteins [BR:bmus04031]
    118892955 (GNA11)
Exosome [BR:bmus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   118892955 (GNA11)
  Exosomal proteins of melanoma cells
   118892955 (GNA11)
GTP-binding proteins [BR:bmus04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    118892955 (GNA11)
SSDB
Motif
Pfam: G-alpha Arf DUF2194 Gtr1_RagA FtsK_SpoIIIE AAA_29
Other DBs
NCBI-GeneID: 118892955
NCBI-ProteinID: XP_036703938
UniProt: A0A8C0CV73
LinkDB
Position
3:168842169..168860422
AA seq 359 aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHRYVSAIKTLWNDPGIQECYDRRREYQLSDSAKYYLTDVDRIATSGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIVTYPWFQNSSVILFLNKKDLLEDKILHSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctgagcgatgaggtgaaggagtccaagcgg
atcaacgccgagatcgagaaacagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctactgctgctcggcacgggcgagagcgggaagagcacgttcatcaagcagatgcgc
atcatccacggggcgggctactcggaggaggacaagcggggcttcacgaagctggtgtac
cagaacatcttcaccgccatgcaggccatgatccgggccatggagaccctgaagatcctc
tacaagtacgagcagaacaaggccaacgcgctcctgatccgggaggtggacgtggagaag
gtgaccaccttcgagcaccggtacgtgagtgccatcaagaccctgtggaacgaccccggc
atccaggagtgctacgaccgccggcgggagtaccagctctcggactccgccaagtactac
ctgactgatgtggaccgcatcgccacctcgggctacctgcccacccagcaggacgtgctg
cgagtgcgcgtgcccaccactggcatcatcgagtaccccttcgacctggagaacatcatc
ttcaggatggtggacgtggggggccagaggtccgagcggaggaagtggatccactgcttt
gagaacgtgacgtccatcatgttcctcgtggccctcagcgagtacgaccaagtgctggtg
gagtcggacaacgagaaccgcatggaggagagcaaagcgctgttccggaccatcgtcacc
tacccctggttccagaactcgtccgtcatcctcttcctcaacaagaaggacctgctggag
gacaagatcctccattcccacctggtggactacttccccgagttcgacggcccacagcgg
gacgcgcaggccgcccgggagttcatcctgaagatgttcgtggacctgaaccccgacagc
gacaagatcatctattcccacttcacgtgcgccaccgacacggagaacatccgctttgtc
ttcgccgctgtcaaggacaccatcctgcagctcaacctgaaggagtacaacctggtgtga

DBGET integrated database retrieval system