Balaenoptera musculus (blue whale): 118899380 Help Entry 118899380         CDS       T09887                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism bmus  Balaenoptera musculus (blue whale) Pathway bmus00510   N-Glycan biosynthesis bmus00513   Various types of N-glycan biosynthesis bmus04141   Protein processing in endoplasmic reticulum Module bmus_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:bmus00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     118899380 (TMEM258)    00513 Various types of N-glycan biosynthesis     118899380 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     118899380 (TMEM258) SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  118899380 NCBI-ProteinID:  XP_036716933 UniProt:  A0A8B8Y3R4 LinkDB All DBs Position 8 Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagcttgaggccatgagcagatacaccagtccagtgaacccggctgtctttccgcat ctgaccgtggtgctgttggccattggcatgttcttcaccgcctggttcttcgtttatgag gtcacctccaccaaatacactcgggatatctacaaagagctcctcatctctttggtggct tcactcttcatgggctttggagtgctcttcctgctgctctgggtcggcatctacgtatga

DBGET integrated database retrieval system